Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04024
Gene name
Locationscaffold_04:658938..661292
Strand+
Gene length (bp)2354
Transcript length (bp)1398
Coding sequence length (bp)1398
Protein length (aa) 466

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family 1.7E-29 341 452

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0019222 regulation of metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6549 0.6927 0.0881 0.0215 0.0511 0.0045 0.1051 0.0392 0.032 0.0603

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2479
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6056
Ophiocordyceps australis map64 (Brazil) OphauB2|2744
Ophiocordyceps camponoti-floridani Ophcf2|04024 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1970
Ophiocordyceps kimflemingae Ophio5|5847
Ophiocordyceps subramaniannii Hirsu2|3579

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04024
MNRPVPQTLRGMPGNFGGQPQPQQQGRPVSNRLPNGKMANNASSWGFGGGLPMGASGFPNQAHQLGGNLSFAQSL
TGSQPATPLDLSEFPSLANNSQLNTTGQPSLWSASGSRNPNGPVQRSQSIPVTTQPSGQDDLFNPSSSRVPPNQA
ANGYLRSERTANMMSSLGFAPQSSSSAHVQANKGNGLLNALSANSRANEARSPPGGGASASSRAPDAKRPDDMRQ
KAPMFRDDGFGKTPAGDGAMQATGARSQLGAIGNEGSQGKLKDDKASQHPEAVDPLAGMAAVDKWGIKGLRTLMN
NYPDFHAMVVGMDPSTLGLDLSTQELISPQIYSLFDEQPPRPTVTSSKFRLPDCYSVTNVQPIESKIQSFNEETL
FWLFYSCPADMKQQMAAVELHSRNWRWHKKLQIWLTKDEHMNPQILSPNHERGYYIVWDANNWRKDRREFTLHYG
DLDTTLNAAPTLNMS*
Coding >Ophcf2|04024
ATGAATCGGCCAGTGCCGCAAACGCTACGGGGCATGCCTGGCAACTTCGGAGGCCAACCACAACCTCAGCAACAA
GGACGACCGGTATCGAATCGGCTGCCAAACGGGAAGATGGCCAATAATGCCTCGAGCTGGGGTTTTGGCGGCGGC
CTTCCCATGGGAGCTTCAGGTTTTCCCAACCAAGCGCATCAGCTGGGCGGAAACCTTAGCTTCGCTCAGAGCTTG
ACGGGGTCACAACCTGCTACGCCGTTGGATCTATCAGAATTTCCCTCTTTAGCGAATAACTCGCAACTGAACACT
ACCGGGCAGCCCTCACTGTGGTCGGCTTCCGGCTCGCGAAACCCCAACGGCCCCGTTCAGCGCAGCCAGTCCATC
CCGGTCACCACCCAGCCTTCAGGACAAGACGACCTGTTCAACCCTTCATCTTCTCGGGTGCCGCCCAATCAAGCT
GCCAACGGTTATCTTCGATCGGAACGGACCGCCAACATGATGTCCTCGCTAGGTTTCGCGCCTCAAAGCTCCAGC
TCGGCACATGTGCAGGCGAACAAAGGCAACGGGCTGCTGAATGCCTTGTCTGCAAACAGCCGGGCCAATGAGGCG
CGGTCGCCGCCTGGAGGAGGTGCATCAGCTTCATCACGAGCACCGGATGCGAAGCGACCCGATGATATGAGGCAG
AAGGCGCCCATGTTCCGCGATGATGGCTTCGGCAAGACACCTGCAGGCGACGGGGCGATGCAGGCGACTGGCGCA
AGGAGCCAGCTTGGCGCCATCGGAAACGAGGGTTCGCAGGGAAAGTTGAAGGACGACAAGGCGAGCCAACATCCG
GAAGCTGTCGACCCTCTGGCAGGTATGGCGGCCGTTGACAAGTGGGGCATCAAGGGTCTGCGAACTCTGATGAAC
AACTATCCCGACTTTCATGCCATGGTGGTGGGCATGGATCCGAGCACGTTGGGGCTGGACTTGAGCACTCAAGAG
CTCATTTCTCCGCAAATCTACTCCCTGTTCGACGAGCAACCGCCGAGACCGACGGTAACGTCGAGCAAATTCCGG
CTTCCCGATTGCTATAGCGTCACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAACGAGGAGACGTTA
TTTTGGCTCTTCTACAGCTGTCCGGCAGACATGAAGCAGCAAATGGCGGCAGTGGAGCTGCATTCTCGAAACTGG
CGGTGGCACAAGAAGCTGCAGATCTGGCTCACCAAGGATGAGCACATGAACCCGCAAATTCTGAGCCCCAACCAC
GAGCGAGGCTACTACATCGTATGGGACGCAAATAACTGGCGGAAAGATCGAAGAGAGTTTACGCTGCACTACGGG
GATCTGGACACGACGCTGAACGCGGCACCGACATTAAATATGTCGTAG
Transcript >Ophcf2|04024
ATGAATCGGCCAGTGCCGCAAACGCTACGGGGCATGCCTGGCAACTTCGGAGGCCAACCACAACCTCAGCAACAA
GGACGACCGGTATCGAATCGGCTGCCAAACGGGAAGATGGCCAATAATGCCTCGAGCTGGGGTTTTGGCGGCGGC
CTTCCCATGGGAGCTTCAGGTTTTCCCAACCAAGCGCATCAGCTGGGCGGAAACCTTAGCTTCGCTCAGAGCTTG
ACGGGGTCACAACCTGCTACGCCGTTGGATCTATCAGAATTTCCCTCTTTAGCGAATAACTCGCAACTGAACACT
ACCGGGCAGCCCTCACTGTGGTCGGCTTCCGGCTCGCGAAACCCCAACGGCCCCGTTCAGCGCAGCCAGTCCATC
CCGGTCACCACCCAGCCTTCAGGACAAGACGACCTGTTCAACCCTTCATCTTCTCGGGTGCCGCCCAATCAAGCT
GCCAACGGTTATCTTCGATCGGAACGGACCGCCAACATGATGTCCTCGCTAGGTTTCGCGCCTCAAAGCTCCAGC
TCGGCACATGTGCAGGCGAACAAAGGCAACGGGCTGCTGAATGCCTTGTCTGCAAACAGCCGGGCCAATGAGGCG
CGGTCGCCGCCTGGAGGAGGTGCATCAGCTTCATCACGAGCACCGGATGCGAAGCGACCCGATGATATGAGGCAG
AAGGCGCCCATGTTCCGCGATGATGGCTTCGGCAAGACACCTGCAGGCGACGGGGCGATGCAGGCGACTGGCGCA
AGGAGCCAGCTTGGCGCCATCGGAAACGAGGGTTCGCAGGGAAAGTTGAAGGACGACAAGGCGAGCCAACATCCG
GAAGCTGTCGACCCTCTGGCAGGTATGGCGGCCGTTGACAAGTGGGGCATCAAGGGTCTGCGAACTCTGATGAAC
AACTATCCCGACTTTCATGCCATGGTGGTGGGCATGGATCCGAGCACGTTGGGGCTGGACTTGAGCACTCAAGAG
CTCATTTCTCCGCAAATCTACTCCCTGTTCGACGAGCAACCGCCGAGACCGACGGTAACGTCGAGCAAATTCCGG
CTTCCCGATTGCTATAGCGTCACCAACGTGCAGCCCATCGAGAGCAAGATCCAGAGCTTCAACGAGGAGACGTTA
TTTTGGCTCTTCTACAGCTGTCCGGCAGACATGAAGCAGCAAATGGCGGCAGTGGAGCTGCATTCTCGAAACTGG
CGGTGGCACAAGAAGCTGCAGATCTGGCTCACCAAGGATGAGCACATGAACCCGCAAATTCTGAGCCCCAACCAC
GAGCGAGGCTACTACATCGTATGGGACGCAAATAACTGGCGGAAAGATCGAAGAGAGTTTACGCTGCACTACGGG
GATCTGGACACGACGCTGAACGCGGCACCGACATTAAATATGTCGTAG
Gene >Ophcf2|04024
ATGAATCGGCCAGGTAGGACAAGTCCAGAATAACCCCCCCTCCCTCCCCCTTGATTCCCTTTGCCAGACTCAGCC
TCGAGCACCCCGCGCCCACGACGATGATTCGATCGAGCCGACGACCGTCCTGACCATCGGCGAGCTGCATGGCTG
TTTCCGTACCTCGCAGACGCAGGCAAGAAGCTGTGCAATTCTCGATTGGCGACAGGCTTGACGCGAGCTCCACGA
CCTCGAGATGTCGAAATTCCGAACGACGGGTGAAACTGGTCCAGCATGGCTCTGTTTCAGGCAGCTTCTGGCTAC
AAAGTTGGCTATCTGTACCATGATGGCCCGCGTCGATTCTTATTCGGTTTCTGACGAGATCTCTTGAATAGTGCC
GCAAACGCTACGGGGCATGCCTGGCAACTTCGGAGGCCAACCACAACCTCAGCAACAAGGACGACCGGTATCGAA
TCGGCTGCCAAACGGGAAGATGGGTTCGCATTTCCCGACTCATCTTGGAGGTACGCTGCTTGTGGCTGACGAGAG
ACGTTTGCCAGCCAATAATGCCTCGAGCTGGGGTTTTGGCGGCGGCCTTCCCATGGGAGCTTCAGGTTTTCCCAA
CCAAGCGCATCAGCTGGGCGGAAACCTTAGCTTCGCTCAGAGCTTGACGGGGTCACAACCTGCTACGCCGTTGGA
TCTATCGTACGTATCTAAGCCTTCTCTCCCCTTATCTATCAGCCTGCCTATCTGCTTTTTGTCGATTTCTCTCTG
CCCGCTTGTATGAATCATGCTGTGGCAGCAAGTCTTGGCAGTAATGCCAGGTGCTAGCGAAGTTGATCGCTACTC
CCACCTCTTCCCGGGCACACGGTTTCTGCTTCCTCATCCAAGTTCCACCTACCTCGCGAACCTTCTTTGGCCGCA
TCACAACTTTGACAAGCAAGCGTACTAACTATCTCTAGAGAATTTCCCTCTTTAGCGAATAACTCGCAACTGAAC
ACTACCGGGCAGCCCTCACTGTGGTCGGCTTCCGGCTCGCGAAACCCCAACGGCCCCGTTCAGCGCAGCCAGTCC
ATCCCGGTCACCACCCAGCCTTCAGGACAAGACGACCTGTTCAACCCTTCATCTTCTCGGGTGCCGCCCAATCAA
GGTTCGTTACAAAGCTTCTCCGTCCTCTCTCGGGTTCTGTCGGGCAGCGTTGACGTTCCAACCGCAGCTGCCAAC
GGTTATCTTCGATCGGAACGGACCGCCAACATGATGTCCTCGCTAGGTTTCGCGCCTCAAAGCTCCAGCTCGGCA
CATGTGCAGGCGAACAAAGGCAACGGGCTGCTGAATGCCTTGTCTGCAAACAGCCGGGCCAATGAGGCGCGGTCG
CCGCCTGGAGGAGGTGCATCAGGTAGGTCTACCCCTCTTTGATGGTGTGTCTCACCGTGTGTTGACCTCGGCCAG
CTTCATCACGAGCACCGGATGCGAAGCGACCCGATGATATGAGGCAGAAGGCGCCCATGTTCCGCGATGATGGCT
TCGGCAAGACACCTGCAGGCGACGGGGCGATGCAGGCGACTGGCGCAAGGAGCCAGCTTGGCGCCATCGGAAACG
AGGGTTCGCAGGGAAAGTTGAAGGACGACAAGGCGAGCCAACATCCGGAAGCTGTCGACCCTCTGGCAGGTATGG
CGGCCGTTGACAAGTGGGGCATCAAGGGTCTGCGAACTCTGATGAACAACTATCCCGACTTTCATGCCATGGTGG
TGGGCATGGATCCGAGCACGTTGGGGCTGGACTTGAGCACTCAAGAGTAAGTGTCTCTGAGGCGCATATGGCGCG
TTTATTGACACTGGCTAACGACGCAAAAGGCTCATTTCTCCGCAAATCTACTCCCTGTTCGACGAGCAACCGCCG
AGACCGACGGTAACGTCGAGCAAATTCCGGCTTCCCGATTGCTATAGCGTCACCAACGTGCAGCCCATCGAGAGC
AAGATCCAGAGCTTCAACGAGGAGACGTTATTTTGGCTCTTCTACAGCTGTCCGGCAGACATGAAGCAGCAAATG
GCGGCAGTGGAGCTGTAAGAAAACCCCGCTACCGTTGAAGCCGGCTCTAACGATTCGACAGGCATTCTCGAAACT
GGCGGTGGCACAAGAAGCTGCAGATCTGGCTCACCAAGGATGAGCACATGAACCCGCAAATTCTGAGCCCCAACC
ACGAGCGAGGCTACTACATCGTATGGGACGCAAATAACTGGCGGAAAGATCGAGTAAGTGACGTGTGCCCCGTTG
TGGCCGGACAAGTGCTGACCCGAGGACCTCAGAGAGAGTTTACGCTGCACTACGGGGATCTGGACACGACGCTGA
ACGCGGCACCGACATTAAATATGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail