Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04023
Gene name
Locationscaffold_04:657142..658546
Strand+
Gene length (bp)1404
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02492 cobW CobW/HypB/UreG, nucleotide-binding domain 2.5E-46 27 211
PF07683 CobW_C Cobalamin synthesis protein cobW C-terminal domain 3.5E-05 281 344

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7814 0.4011 0.0208 0.031 0.2398 0.0154 0.1019 0.1732 0.2025 0.0309

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2481
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6055
Ophiocordyceps australis map64 (Brazil) OphauB2|2745
Ophiocordyceps camponoti-floridani Ophcf2|04023 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1971
Ophiocordyceps kimflemingae Ophio5|5848
Ophiocordyceps subramaniannii Hirsu2|3580

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04023
MESDGDAPPDLVDTAEELPAELSVKVPITIVTGYLGAGKTTLLNYILTARHGKKIAVIMNEFGDSLDIEKSLTVN
KGEESFEEWLEVGNGCICCSVKDTGVNAIESLMSKKGAFDYILLETTGLADPGNIAPLFWVDDGLGSTIYLDGIV
TLVDARNILHSLEDASGKVDELEQHGHKGPLMTTAHLQISHADVVVVNKADLVNDEELRLLEGFLLDLHAYDEFK
ESDFAAKGHSHLDPAISTICVPVPRLQPHQLALVDAWLRELLWENRVPGSQDQGKFEIHRSKGRIVLENGEAKML
QGVREVFELSEPPDSGEPQPTEGKMIFIGRRLAEASLADSFRRAMHNS*
Coding >Ophcf2|04023
ATGGAGTCCGATGGAGATGCACCTCCCGACTTGGTGGATACCGCAGAGGAGCTGCCAGCCGAACTGTCGGTCAAA
GTGCCAATTACTATTGTGACCGGTTACCTCGGAGCCGGAAAGACAACTCTCTTGAATTATATCCTCACGGCTCGG
CATGGGAAAAAGATTGCTGTCATCATGAATGAGTTTGGCGACTCGCTGGACATCGAGAAGTCCTTGACTGTCAAC
AAAGGCGAAGAAAGTTTTGAGGAGTGGCTGGAAGTCGGAAATGGTTGTATTTGTTGTTCCGTCAAAGACACAGGA
GTCAATGCAATCGAGTCCCTTATGAGCAAAAAAGGCGCCTTTGACTACATTCTACTAGAGACTACCGGCCTTGCC
GATCCCGGAAATATCGCTCCTCTCTTCTGGGTAGATGACGGCCTGGGAAGCACGATATACCTCGATGGAATCGTC
ACTCTCGTCGACGCCAGAAATATCCTGCACAGCCTGGAAGATGCGAGCGGCAAGGTGGACGAGCTTGAGCAGCAC
GGCCACAAGGGTCCTCTGATGACGACGGCGCACCTTCAAATCTCACATGCAGATGTCGTCGTCGTTAATAAGGCA
GATCTAGTCAACGACGAGGAGCTTCGTCTGCTTGAAGGCTTCCTGTTGGACTTGCACGCGTACGACGAATTCAAG
GAAAGCGATTTCGCGGCCAAGGGGCATAGCCATCTGGACCCGGCGATTTCGACAATCTGCGTTCCGGTTCCTCGA
CTGCAGCCGCATCAATTGGCCCTTGTTGATGCTTGGCTGCGAGAACTGCTCTGGGAGAACAGGGTTCCGGGCTCA
CAGGACCAGGGGAAATTTGAAATTCACCGCTCCAAGGGCCGTATCGTGCTTGAGAACGGGGAGGCTAAGATGCTT
CAGGGCGTCAGAGAGGTGTTTGAACTATCGGAGCCGCCAGACAGCGGGGAGCCACAGCCAACCGAGGGCAAGATG
ATCTTCATCGGAAGGCGGCTGGCAGAAGCAAGCCTGGCGGATAGTTTCAGAAGAGCTATGCACAATAGCTGA
Transcript >Ophcf2|04023
ATGGAGTCCGATGGAGATGCACCTCCCGACTTGGTGGATACCGCAGAGGAGCTGCCAGCCGAACTGTCGGTCAAA
GTGCCAATTACTATTGTGACCGGTTACCTCGGAGCCGGAAAGACAACTCTCTTGAATTATATCCTCACGGCTCGG
CATGGGAAAAAGATTGCTGTCATCATGAATGAGTTTGGCGACTCGCTGGACATCGAGAAGTCCTTGACTGTCAAC
AAAGGCGAAGAAAGTTTTGAGGAGTGGCTGGAAGTCGGAAATGGTTGTATTTGTTGTTCCGTCAAAGACACAGGA
GTCAATGCAATCGAGTCCCTTATGAGCAAAAAAGGCGCCTTTGACTACATTCTACTAGAGACTACCGGCCTTGCC
GATCCCGGAAATATCGCTCCTCTCTTCTGGGTAGATGACGGCCTGGGAAGCACGATATACCTCGATGGAATCGTC
ACTCTCGTCGACGCCAGAAATATCCTGCACAGCCTGGAAGATGCGAGCGGCAAGGTGGACGAGCTTGAGCAGCAC
GGCCACAAGGGTCCTCTGATGACGACGGCGCACCTTCAAATCTCACATGCAGATGTCGTCGTCGTTAATAAGGCA
GATCTAGTCAACGACGAGGAGCTTCGTCTGCTTGAAGGCTTCCTGTTGGACTTGCACGCGTACGACGAATTCAAG
GAAAGCGATTTCGCGGCCAAGGGGCATAGCCATCTGGACCCGGCGATTTCGACAATCTGCGTTCCGGTTCCTCGA
CTGCAGCCGCATCAATTGGCCCTTGTTGATGCTTGGCTGCGAGAACTGCTCTGGGAGAACAGGGTTCCGGGCTCA
CAGGACCAGGGGAAATTTGAAATTCACCGCTCCAAGGGCCGTATCGTGCTTGAGAACGGGGAGGCTAAGATGCTT
CAGGGCGTCAGAGAGGTGTTTGAACTATCGGAGCCGCCAGACAGCGGGGAGCCACAGCCAACCGAGGGCAAGATG
ATCTTCATCGGAAGGCGGCTGGCAGAAGCAAGCCTGGCGGATAGTTTCAGAAGAGCTATGCACAATAGCTGA
Gene >Ophcf2|04023
ATGGAGTCCGATGGAGATGCACCTCCCGACTTGGTGGATACCGCAGAGGAGCTGCCAGCCGAACTGTCGGTCAAA
GTGCCAATTACTATTGTGACCGGTGCGTCGACGAGCTCCGAGATGGCCATGACAACCGTTGCGGGCATGGAGTGG
ACAAGTCTCAATCATTGGGCCAGGTTACCTCGGAGCCGGAAAGACAACTCTCTTGAATTATATCCTCACGGCTCG
GCATGGGAAAAAGATTGCTGTCATCATGAATGGTTGTGAAATCGCCAGTCGCCACTACTTGTGCCCCTACTGACG
CCGAGCAGAGTTTGGCGACTGTGAGTGACGGTGACTGCATGTGACTGGGAGACGTCCTAATTACGACGCAGCGCT
GGACATCGAGAAGTCCTTGACTGTCAACAAAGGCGAAGAAAGTTTTGAGGAGTGGCTGGAAGTCGGAAATGGTTG
TATTTGTTGTTCCGTCAAGTTCGTTCAGCCACAGTCATTGTCATCAATTCCCGCTTACGCCCTCCAGAGACACAG
GAGTCAATGCAATCGAGTCCCTTATGAGCAAAAAAGGCGCCTTTGACTACATTCTACTAGAGACTACCGGCCTTG
CCGATCCCGGAAATATCGCTCCTCTCTTCTGGGTAGATGACGGCCTGGGAAGCACGATATACCTCGATGGAATCG
TCACTCTCGTCGACGCCAGAAATATCCTGCACAGCCTGGAAGATGCGAGCGGCAAGGTGGACGAGCTTGAGCAGC
ACGGCCACAAGGGTCCTCTGATGACGACGGCGCACCTTCAAATCTCACATGCAGATGTCGTCGTCGTTAATAAGG
CAGATCTAGTCAACGACGAGGAGCTTCGTCTGGTAAGAGAAAGAGTCGAATCTATCAACGGGCTCGCAAGGGTGC
ATGTGACAGAGCGGAGCGTTGTCCCGCAGCTTGAAGGCTTCCTGTTGGACTTGCACGCGTACGACGAATTCAAGG
AAAGCGATTTCGCGGCCAAGGGGCATAGCCATCTGGACCCGGTGAGCGACGAGAGCGGCGTTCGCTCAAAAAAGG
CACCCATGGGACTGACGGATACAGGCGATTTCGACAATCTGCGTTCCGGTTCCTCGACTGCAGCCGCATCAATTG
GCCCTTGTTGATGCTTGGCTGCGAGAACTGCTCTGGGAGAACAGGGTTCCGGGCTCACAGGACCAGGGGAAATTT
GAAATTCACCGCTCCAAGGGCCGTATCGTGCTTGAGAACGGGGAGGCTAAGATGCTTCAGGGCGTCAGAGAGGTG
TTTGAACTATCGGAGCCGCCAGACAGCGGGGAGCCACAGCCAACCGAGGGCAAGATGATCTTCATCGGAAGGCGG
CTGGCAGAAGCAAGCCTGGCGGATAGTTTCAGAAGAGCTATGCACAATAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail