Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04022
Gene name
Locationscaffold_04:655433..656877
Strand-
Gene length (bp)1444
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03637 Mob1_phocein Mob1/phocein family 3.1E-25 102 263

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6719 0.4875 0.1085 0.1533 0.1265 0.0077 0.1606 0.3003 0.3407 0.0595

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2482
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6054
Ophiocordyceps australis map64 (Brazil) OphauB2|2746
Ophiocordyceps camponoti-floridani Ophcf2|04022 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1972
Ophiocordyceps kimflemingae Ophio5|5849
Ophiocordyceps subramaniannii Hirsu2|3581

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04022
MALAPSSPRLPSPPPAAEIQIGPKSPSGGTTVSPQAMQMEQTVLDARSKRRIHPGTKAADMAAGPPLVPLGELDS
AFQLQEHLSALHYHYTASATQAITRETALQLAHPPQGIDRSLWLYELCRFLIAQCNSLIVGFLFDTPPCCAETCP
EMRASEWQFLCAVHEQPKSCCAIDYCCHTLDWAANVVSDQKIFPSRFVALSDSPSKNVGVKNLINVFRRLHRIFA
HAWFQHRTVFWTVEGQAGLYVFFKTVCDLYDLLPSENYKLPPEAEGLEAPAAEPEPQRPAPTILKPPLQHGNDEG
VHSIGRTNTRRHIRSSPSTGSAVTTVHETDEEDADAASSKLRELGLTEQDHAADDEPEVAEVPVIVEQCELVDAI
ASDSSDSEDLPTTEAGKPATTKAHQELDDTADGSNVVPGASSSEDAAHDADSPPVLDPQPGSPPASAEQCEDPAE
SKEEVEKAVNETS*
Coding >Ophcf2|04022
ATGGCCTTGGCTCCGAGCTCGCCTCGCCTGCCCAGCCCTCCGCCAGCTGCAGAGATACAGATCGGCCCCAAATCC
CCCTCAGGAGGAACGACGGTCAGCCCGCAGGCCATGCAGATGGAGCAAACAGTCCTCGATGCTCGCTCCAAGAGA
CGCATCCACCCTGGCACCAAGGCCGCCGACATGGCAGCCGGGCCGCCTCTGGTTCCTCTTGGCGAGCTCGACTCT
GCCTTTCAGCTCCAAGAGCATCTCTCGGCCTTGCACTACCACTACACGGCTTCCGCCACGCAGGCCATTACCCGC
GAAACGGCCCTTCAACTGGCTCATCCCCCGCAAGGAATTGATCGCAGCCTGTGGCTTTACGAGCTGTGCCGCTTC
CTCATCGCACAGTGCAACTCGCTCATCGTCGGCTTCTTATTCGACACGCCGCCCTGCTGCGCCGAAACATGCCCC
GAGATGCGAGCGTCCGAATGGCAGTTTCTGTGCGCCGTCCACGAACAGCCCAAGAGCTGCTGCGCCATCGACTAC
TGCTGTCATACTCTCGATTGGGCCGCCAATGTTGTGTCGGATCAAAAAATATTTCCCAGTAGATTTGTCGCCCTC
AGCGACAGCCCTAGCAAAAACGTGGGTGTTAAGAACCTGATAAACGTATTTCGAAGATTGCACAGGATATTTGCA
CACGCCTGGTTCCAGCACCGCACCGTCTTTTGGACTGTCGAGGGACAGGCAGGCCTCTACGTCTTCTTCAAAACC
GTTTGCGATCTGTACGACCTGCTGCCCTCGGAGAATTACAAACTGCCGCCGGAGGCCGAGGGATTGGAAGCTCCG
GCAGCAGAACCCGAGCCTCAGAGGCCCGCCCCAACCATCTTGAAGCCGCCGTTGCAACACGGAAATGACGAGGGC
GTGCACTCTATTGGCCGAACCAACACGCGGAGACATATCCGGAGCAGTCCCTCGACCGGAAGTGCAGTGACGACG
GTTCATGAAACAGACGAGGAAGACGCGGATGCTGCCAGCAGCAAGTTGCGCGAACTGGGCTTGACAGAACAAGAC
CACGCTGCAGACGACGAGCCTGAAGTGGCTGAGGTCCCAGTCATTGTTGAGCAGTGCGAGCTCGTTGACGCGATT
GCATCAGACTCGAGCGATTCAGAGGACCTGCCGACGACAGAAGCTGGAAAACCAGCCACCACCAAGGCACATCAA
GAGCTGGATGATACAGCTGATGGTTCCAACGTGGTTCCAGGAGCGTCATCTTCTGAAGACGCCGCCCACGATGCT
GACTCTCCGCCGGTGCTCGACCCGCAGCCGGGTTCCCCACCGGCCTCGGCAGAGCAATGCGAAGACCCGGCCGAG
TCCAAAGAAGAAGTGGAAAAAGCGGTCAACGAGACTTCCTAG
Transcript >Ophcf2|04022
ATGGCCTTGGCTCCGAGCTCGCCTCGCCTGCCCAGCCCTCCGCCAGCTGCAGAGATACAGATCGGCCCCAAATCC
CCCTCAGGAGGAACGACGGTCAGCCCGCAGGCCATGCAGATGGAGCAAACAGTCCTCGATGCTCGCTCCAAGAGA
CGCATCCACCCTGGCACCAAGGCCGCCGACATGGCAGCCGGGCCGCCTCTGGTTCCTCTTGGCGAGCTCGACTCT
GCCTTTCAGCTCCAAGAGCATCTCTCGGCCTTGCACTACCACTACACGGCTTCCGCCACGCAGGCCATTACCCGC
GAAACGGCCCTTCAACTGGCTCATCCCCCGCAAGGAATTGATCGCAGCCTGTGGCTTTACGAGCTGTGCCGCTTC
CTCATCGCACAGTGCAACTCGCTCATCGTCGGCTTCTTATTCGACACGCCGCCCTGCTGCGCCGAAACATGCCCC
GAGATGCGAGCGTCCGAATGGCAGTTTCTGTGCGCCGTCCACGAACAGCCCAAGAGCTGCTGCGCCATCGACTAC
TGCTGTCATACTCTCGATTGGGCCGCCAATGTTGTGTCGGATCAAAAAATATTTCCCAGTAGATTTGTCGCCCTC
AGCGACAGCCCTAGCAAAAACGTGGGTGTTAAGAACCTGATAAACGTATTTCGAAGATTGCACAGGATATTTGCA
CACGCCTGGTTCCAGCACCGCACCGTCTTTTGGACTGTCGAGGGACAGGCAGGCCTCTACGTCTTCTTCAAAACC
GTTTGCGATCTGTACGACCTGCTGCCCTCGGAGAATTACAAACTGCCGCCGGAGGCCGAGGGATTGGAAGCTCCG
GCAGCAGAACCCGAGCCTCAGAGGCCCGCCCCAACCATCTTGAAGCCGCCGTTGCAACACGGAAATGACGAGGGC
GTGCACTCTATTGGCCGAACCAACACGCGGAGACATATCCGGAGCAGTCCCTCGACCGGAAGTGCAGTGACGACG
GTTCATGAAACAGACGAGGAAGACGCGGATGCTGCCAGCAGCAAGTTGCGCGAACTGGGCTTGACAGAACAAGAC
CACGCTGCAGACGACGAGCCTGAAGTGGCTGAGGTCCCAGTCATTGTTGAGCAGTGCGAGCTCGTTGACGCGATT
GCATCAGACTCGAGCGATTCAGAGGACCTGCCGACGACAGAAGCTGGAAAACCAGCCACCACCAAGGCACATCAA
GAGCTGGATGATACAGCTGATGGTTCCAACGTGGTTCCAGGAGCGTCATCTTCTGAAGACGCCGCCCACGATGCT
GACTCTCCGCCGGTGCTCGACCCGCAGCCGGGTTCCCCACCGGCCTCGGCAGAGCAATGCGAAGACCCGGCCGAG
TCCAAAGAAGAAGTGGAAAAAGCGGTCAACGAGACTTCCTAG
Gene >Ophcf2|04022
ATGGCCTTGGCTCCGAGCTCGCCTCGCCTGCCCAGCCCTCCGCCAGCTGCAGAGATACAGATCGGCCCCAAATCC
CCCTCAGGAGGAACGACGGTCAGCCCGCAGGCCATGCAGATGGAGCAAACAGTCCTCGATGCTCGCTCCAAGAGA
CGCATCCACCCTGGCACCAAGGCCGCCGACATGGCAGCCGGGCCGCCTCTGGTTCCTCTTGGCGAGGTAAGACGG
GTTTTCTCCCCTCCAGCTACTGGGCTAATGCCCCCTTTCCTAGCTCGACTCTGCCTTTCAGCTCCAAGAGCATCT
CTCGGCCTTGCACTACCACTACACGGCTTCCGCCACGCAGGCCATTACCCGCGAAACGGCCCTTCAACTGGCTCA
TCCCCCGCAAGGAATTGATCGCAGCCTGTGGCTTTACGAGCTGTGCCGCTTCCTCATCGCACAGTGCAACTCGCT
CATCGTCGGCTTCTTATTCGACACGCCGCCCTGCTGCGCCGAAACATGCCCCGAGATGCGAGCGTCCGAATGGCA
GTTTCTGTGCGCCGTCCACGAACAGCCCAAGAGCTGCTGCGCCATCGACTACTGCTGTCATACTCTCGATTGGGC
CGCCAATGTTGTGTCGGATCAAAAAATATTTCCCAGTAGATTTGTCGCCCTCAGCGACAGCCCTAGCAAAAACGT
GGGTGTTAAGAACCTGATAAACGTATTTCGAAGATTGCACAGGATATTTGCACACGCCTGGTTCCAGCACCGCAC
CGTCTTTTGGACTGTCGAGGGACAGGCAGGCCTCTACGTCTTCTTCAAAACCGTTTGCGATCTGTACGACCTGCT
GCCCTCGGAGAATTACAAACTGCCGCCGGAGGCCGAGGGATTGGAAGCTCCGGCAGCAGAACCCGAGCCTCAGAG
GCCCGCCCCAACCATCTTGAAGCCGCCGTTGCAACACGGAAATGACGAGGGCGTGCACTCTATTGGCCGAACCAA
CACGCGGAGACATATCCGGAGCAGTCCCTCGACCGGAAGTGCAGTGACGACGGTTCATGAAACAGACGAGGAAGA
CGCGGATGCTGCCAGCAGCAAGTTGCGCGAACTGGGCTTGACAGAACAAGACCACGCTGCAGACGACGAGCCTGA
AGTGGCTGAGGTCCCAGTCATTGTTGAGCAGTGCGAGCTCGTTGACGCGATTGCATCAGACTCGAGCGATTCAGA
GGACCTGCCGACGACAGAAGCTGGAAAACCAGCCACCACCAAGGCACATCAAGAGCTGGATGATACAGCTGATGG
TTCCAACGTGGTTCCAGGAGCGTCATCTTCTGAAGACGCCGCCCACGATGCTGACTCTCCGCCGGTGCTCGACCC
GCAGCCGGGTTCCCCACCGGCCTCGGCAGAGCAATGCGAAGACCCGGCCGAGTCCAAAGAAGAAGTGGAAAAAGC
GGTCAACGAGACTTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail