Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04015
Gene name
Locationscaffold_04:633275..635124
Strand-
Gene length (bp)1849
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 1.0E-14 106 261

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4583 0.8624 0.0574 0.0227 0.1067 0.0804 0.0358 0.0321 0.0555 0.0047

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3932
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|122
Ophiocordyceps australis map64 (Brazil) OphauB2|2755
Ophiocordyceps camponoti-floridani Ophcf2|04015 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1979
Ophiocordyceps kimflemingae Ophio5|8573
Ophiocordyceps subramaniannii Hirsu2|7831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04015
MEGGKRKFVDDDDDDETTEVKIAMLASVHPDVEPEKLLDMLVAHRGSIASTTAALERRKPMAKQQCSLRRYGPIT
SSGRSRKMKAVKKGRTLHVFDPVDVAEHTPCTVVHDFLPAEVAEGLLRELLGEAETFERSSFKLFDNVVESPHSA
AFFVEGGEERVLREEYFYNGSKLTDVRTITPYLEKVKPRVQQVVNREIQHRIATHYPNGRKLRHQPPGPWTANSA
FVNCYGGGNESVGWHSDQLTYLGPRAVIGSLSLGVTPASHHPRPASSLDAASRG*
Coding >Ophcf2|04015
ATGGAGGGTGGGAAGAGGAAGTTTGTTGATGATGATGATGATGATGAGACGACGGAGGTCAAGATTGCGATGCTT
GCTTCGGTGCATCCGGATGTTGAACCGGAGAAGTTGCTGGATATGCTGGTCGCTCATCGGGGGTCCATCGCCAGC
ACGACAGCAGCCCTTGAACGACGGAAACCAATGGCGAAGCAGCAATGCTCGCTCCGAAGGTACGGGCCCATCACA
TCATCCGGCAGAAGCAGGAAGATGAAGGCGGTCAAGAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTG
GCGGAGCATACGCCTTGCACGGTGGTGCATGATTTCTTGCCGGCCGAGGTGGCAGAGGGTCTGCTGAGGGAGTTG
TTGGGGGAGGCGGAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGACAATGTTGTTGAGAGTCCGCACTCGGCT
GCTTTTTTTGTCGAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTATAATGGGTCCAAGTTGACGGAC
GTGCGAACCATCACGCCCTACCTGGAAAAGGTCAAGCCACGCGTCCAACAAGTCGTCAACCGGGAAATCCAGCAT
CGCATAGCGACACACTACCCCAACGGCCGCAAACTCCGACACCAACCTCCCGGCCCGTGGACGGCCAACTCGGCC
TTTGTCAACTGCTACGGCGGCGGCAACGAGAGCGTCGGCTGGCATAGCGATCAGCTCACCTACCTCGGACCGCGA
GCCGTCATCGGCTCCCTCTCTTTGGGGGTGACGCCCGCGTCCCATCATCCTCGACCCGCATCTTCGCTGGACGCC
GCGTCACGAGGATAA
Transcript >Ophcf2|04015
ATGGAGGGTGGGAAGAGGAAGTTTGTTGATGATGATGATGATGATGAGACGACGGAGGTCAAGATTGCGATGCTT
GCTTCGGTGCATCCGGATGTTGAACCGGAGAAGTTGCTGGATATGCTGGTCGCTCATCGGGGGTCCATCGCCAGC
ACGACAGCAGCCCTTGAACGACGGAAACCAATGGCGAAGCAGCAATGCTCGCTCCGAAGGTACGGGCCCATCACA
TCATCCGGCAGAAGCAGGAAGATGAAGGCGGTCAAGAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTG
GCGGAGCATACGCCTTGCACGGTGGTGCATGATTTCTTGCCGGCCGAGGTGGCAGAGGGTCTGCTGAGGGAGTTG
TTGGGGGAGGCGGAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGACAATGTTGTTGAGAGTCCGCACTCGGCT
GCTTTTTTTGTCGAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTATAATGGGTCCAAGTTGACGGAC
GTGCGAACCATCACGCCCTACCTGGAAAAGGTCAAGCCACGCGTCCAACAAGTCGTCAACCGGGAAATCCAGCAT
CGCATAGCGACACACTACCCCAACGGCCGCAAACTCCGACACCAACCTCCCGGCCCGTGGACGGCCAACTCGGCC
TTTGTCAACTGCTACGGCGGCGGCAACGAGAGCGTCGGCTGGCATAGCGATCAGCTCACCTACCTCGGACCGCGA
GCCGTCATCGGCTCCCTCTCTTTGGGGGTGACGCCCGCGTCCCATCATCCTCGACCCGCATCTTCGCTGGACGCC
GCGTCACGAGGATAA
Gene >Ophcf2|04015
ATGGAGGGTGGGAAGAGGAAGTTTGTTGATGATGATGATGATGATGAGACGACGGAGGTCAAGATTGCGATGCTT
GCTTCGGTGCATCCGGATGTTGAACCGGAGAAGTTGCTGGATATGCTGGTCGCTCATCGGGGGTCCATCGCCAGC
ACGACAGCAGCCCTTGAACGACGGAAACCAATGGCGAAGCAGCAATGCTCGCTCCGAAGGTACGGGCCCATCACA
TCATCCGGCAGAAGCAGGAAGATGAAGGCGGTCAAGAAGGGGAGGACGCTTCACGTGTTTGACCCCGTGGACGTG
GCGGAGCATACGCCTTGCACGGTGGTGCATGATTTCTTGCCGGCCGAGGTGGCAGAGGGTCTGCTGAGGGAGTTG
TTGGGGGAGGCGGAGACGTTTGAGAGGTCGAGCTTCAAGTTGTTTGACAATGTTGTTGAGAGTCCGCACTCGGCT
GCTTTTTTTGTCGAGGGGGGGGAGGAGAGGGTTTTGAGGGAGGAGTATTTCTATAATGGGTCCAAGTTGACGGTA
TGTCTTTCGTTTCTACGAGTATGTCGGTATGGAACTGACGAGACAGGACGTGCGAACCATCACGCCCTACCTGGA
AAAGGTCAAGCCACGCGTCCAACAAGTCGTCAACCGGGAAATCCAGCATCGCATAGCGACACACTACCCCAACGG
CCGCAAACTCCGACACCAACCTCCCGGCCCGTGGACGGCCAACTCGGCCTTTGTCAACTGCTACGGCGGCGGCAA
CGAGAGCGTCGGCTGGCATAGCGATCAGCTCACCTACCTCGGACCGCGAGCCGTCATCGGCTCCCTCTCTTTGGG
GGTGACGCGTGAGTTTCGCGTGCGGAGGGTGGCGGTGGGTGATGGTGGTGGTGATGGTGATGATGATGATGTTGA
TGGGGGGGTTGGGGATGCGCAAGGGGTGATTTCGATTCATCTTCCGCATAATTCGCTGCTGGTGATGCATGCCGA
GATGCAGGAGGAGTGGAAGCATTGCGTTGCGCCGGCTGCGGCCATCGACGCGCATCCTGTGTCTGGGAACCGGCG
GATCAACATCACGTACCGGGATTATCGCGCGGTGATGCATCCGCGGAGGACGCCGCGTTGCGCGTGTGGTGTTCC
GTGTGTGTTGAGGGTTGTTCAGAAGAAGAGGGAGAAGGTTGGGAGGTATTTCTGGATGTGTCATGCTGGGAATGT
GCCTGGAAGATCGGGGTGCTCCATGTTTCGTTGGGCTGAGTTTGACGATGATGGGAATCCGGTGGAGGGGAATCC
GGTGGAGGGGAATCCGGTGGAGGGGAATCCGATGGAGAAAGGGTCGGGCCGGATGGGGGAGGCTGAGGGGGATGT
GATTGGCGGCAAGGAAGAAGAGTCGTGAACTCGTGATTGATACTCAGCTGATAAACAAAAACCGGACACCGCCAG
CCAGCCGAGAAGAGCACATATATGGATGGATACCTACATAACTGCGTACGTACGAAGAAAAACATACATAGGTGC
GTACGATGATGGACGACAACCTCACCTTTCCCGCCGAGGCAGCAGCCCGTCTCGAGAAATGGCTCCCGCGTCCCA
TGCCCGACCGCCCCTTCGTGACCCTCACATACGCCAGCTCCCTCGACGGCAAGCTCTCTCTCGCCCCGGGAACAC
GCACCCGACTCTCGGGCCCAGAATCCAAAGCGATGACGCACTTCCTCCGCTCCCGCCACGACGCAATCCTCATCG
GCGTCTCAACCCTCCTGGCCGACGACCCAGCTCTAAACTGCCGCCTCGCGACGCCCACCCCCAACCAGCCGCGTC
CCATCATCCTCGACCCGCATCTTCGCTGGACGCCGCGTCACGAGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail