Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04010
Gene name
Locationscaffold_04:619355..620783
Strand+
Gene length (bp)1428
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 6.3E-45 73 327
PF02535 Zip ZIP Zinc transporter 5.3E-10 354 407

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0006812 cation transport No
GO:0008324 cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0006811 ion transport No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.0969 0.1318 0.2731 0.196 0.148 0.055 0.7139 0.5433 0.4449 0.0123

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999744

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 72 94 22
3 101 123 22
4 146 163 17
5 298 320 22
6 355 377 22
7 390 409 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5517
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6972
Ophiocordyceps australis map64 (Brazil) OphauB2|4214
Ophiocordyceps camponoti-floridani Ophcf2|04010 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2828
Ophiocordyceps kimflemingae Ophio5|8579
Ophiocordyceps subramaniannii Hirsu2|6789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04010
MRIQTQMLALAASLLIATAAAHSILSLSELDEKLQTCSVVQQLNAVKAQHHASHPPSSTARLFGMLFPSSRPAVN
ALLATLYISGPPNFLLALCPTNIDPSSLSVMVAFAVGGLLGDTLFHLLPEIFLGEDDDERARLVLVEPNRNLLLG
LGILVGFMTFVAMDKGLRIATGGSGHDHGHGHERGHAEPRHEVASSTTTGAEAAAIQVKSRKKKGEREVGAAEPT
DKQAVNPSVKLGGYLNLIADFTHNITDGLAMSASFYASPTVGATTTMAVFFHEIPHEVGDFALLVQSGFSKRAAM
ASQFVTAVGALLGTLIGIAVQEMGGSGGGGGGGEGAAALPRDGGIWGTSLSWGDMLLPFTAGTFLYVGTVAVIPE
LLETGPRKMEELRKTMVQFAAVAVGAGVMLYISWH*
Coding >Ophcf2|04010
ATGCGAATCCAGACGCAGATGCTGGCCCTCGCAGCGTCGCTGCTCATCGCGACCGCAGCAGCCCACAGCATCCTG
AGTCTGAGCGAGCTAGACGAGAAGCTCCAGACGTGCTCTGTTGTTCAGCAGCTCAATGCAGTCAAGGCGCAGCAC
CACGCGTCTCATCCACCCTCGTCGACGGCCCGTCTCTTCGGCATGCTGTTCCCCAGCTCGCGGCCGGCTGTCAAC
GCGTTGCTGGCGACGCTGTACATCTCGGGACCGCCGAATTTTCTGCTGGCGTTGTGTCCGACGAACATCGATCCT
TCGTCTTTGAGTGTCATGGTGGCTTTTGCTGTGGGCGGCTTGCTGGGTGATACGCTCTTTCATCTGCTGCCGGAG
ATCTTTTTGGGTGAGGATGACGATGAGAGGGCGCGGTTGGTGCTCGTGGAGCCGAATCGCAATTTGCTGTTGGGG
CTTGGCATCTTGGTCGGCTTCATGACTTTTGTTGCTATGGATAAGGGGCTGCGCATCGCTACGGGAGGTTCGGGA
CATGATCATGGTCACGGACATGAACGTGGCCATGCTGAGCCGCGACACGAGGTTGCATCGTCGACGACGACGGGC
GCAGAGGCCGCGGCGATACAGGTCAAGTCGAGGAAGAAAAAGGGAGAGCGAGAGGTCGGGGCCGCTGAGCCGACG
GATAAGCAGGCTGTCAATCCCAGTGTGAAGCTGGGCGGTTACCTCAACCTCATCGCCGACTTTACGCACAACATC
ACCGACGGGCTGGCCATGTCTGCCAGCTTCTACGCGTCGCCGACGGTGGGCGCCACCACCACCATGGCCGTCTTC
TTCCACGAGATCCCGCACGAGGTGGGCGACTTTGCGCTGCTGGTCCAGTCGGGCTTCTCCAAGCGCGCGGCCATG
GCGTCTCAGTTCGTAACGGCTGTCGGCGCCCTGCTGGGGACCCTCATTGGCATTGCCGTGCAGGAGATGGGAGGA
AGTGGTGGTGGCGGTGGTGGCGGTGAGGGTGCTGCAGCCCTGCCACGCGACGGCGGCATTTGGGGGACGAGCCTC
AGCTGGGGGGATATGCTGCTGCCCTTTACGGCCGGCACCTTTTTGTACGTCGGCACCGTCGCCGTCATCCCCGAG
CTGTTGGAGACGGGGCCGAGGAAGATGGAGGAGCTTCGCAAGACGATGGTGCAGTTTGCCGCCGTGGCCGTGGGC
GCGGGAGTGATGCTATACATTTCGTGGCATTAG
Transcript >Ophcf2|04010
ATGCGAATCCAGACGCAGATGCTGGCCCTCGCAGCGTCGCTGCTCATCGCGACCGCAGCAGCCCACAGCATCCTG
AGTCTGAGCGAGCTAGACGAGAAGCTCCAGACGTGCTCTGTTGTTCAGCAGCTCAATGCAGTCAAGGCGCAGCAC
CACGCGTCTCATCCACCCTCGTCGACGGCCCGTCTCTTCGGCATGCTGTTCCCCAGCTCGCGGCCGGCTGTCAAC
GCGTTGCTGGCGACGCTGTACATCTCGGGACCGCCGAATTTTCTGCTGGCGTTGTGTCCGACGAACATCGATCCT
TCGTCTTTGAGTGTCATGGTGGCTTTTGCTGTGGGCGGCTTGCTGGGTGATACGCTCTTTCATCTGCTGCCGGAG
ATCTTTTTGGGTGAGGATGACGATGAGAGGGCGCGGTTGGTGCTCGTGGAGCCGAATCGCAATTTGCTGTTGGGG
CTTGGCATCTTGGTCGGCTTCATGACTTTTGTTGCTATGGATAAGGGGCTGCGCATCGCTACGGGAGGTTCGGGA
CATGATCATGGTCACGGACATGAACGTGGCCATGCTGAGCCGCGACACGAGGTTGCATCGTCGACGACGACGGGC
GCAGAGGCCGCGGCGATACAGGTCAAGTCGAGGAAGAAAAAGGGAGAGCGAGAGGTCGGGGCCGCTGAGCCGACG
GATAAGCAGGCTGTCAATCCCAGTGTGAAGCTGGGCGGTTACCTCAACCTCATCGCCGACTTTACGCACAACATC
ACCGACGGGCTGGCCATGTCTGCCAGCTTCTACGCGTCGCCGACGGTGGGCGCCACCACCACCATGGCCGTCTTC
TTCCACGAGATCCCGCACGAGGTGGGCGACTTTGCGCTGCTGGTCCAGTCGGGCTTCTCCAAGCGCGCGGCCATG
GCGTCTCAGTTCGTAACGGCTGTCGGCGCCCTGCTGGGGACCCTCATTGGCATTGCCGTGCAGGAGATGGGAGGA
AGTGGTGGTGGCGGTGGTGGCGGTGAGGGTGCTGCAGCCCTGCCACGCGACGGCGGCATTTGGGGGACGAGCCTC
AGCTGGGGGGATATGCTGCTGCCCTTTACGGCCGGCACCTTTTTGTACGTCGGCACCGTCGCCGTCATCCCCGAG
CTGTTGGAGACGGGGCCGAGGAAGATGGAGGAGCTTCGCAAGACGATGGTGCAGTTTGCCGCCGTGGCCGTGGGC
GCGGGAGTGATGCTATACATTTCGTGGCATTAG
Gene >Ophcf2|04010
ATGCGAATCCAGACGCAGATGCTGGCCCTCGCAGCGTCGCTGCTCATCGCGACCGCAGCAGCCCACAGCATCCTG
AGTCTGAGCGAGCTAGACGAGAAGCTCCAGGTTCGCGCGCCTCAGCACGTGCGGCTTCACAGGGGACTAACGGGA
CGATGCCAGACGTGCTCTGTTGTTCAGCAGCTCAATGCAGTCAAGGCGCAGCACCACGCGTCTCATCCACCCTCG
TCGACGGCCCGTCTCTTCGGCATGCTGTTCCCCAGCTCGCGGCCGGCTGTCAACGCGTTGCTGGCGACGCTGTAC
ATCTCGGGACCGCCGAATTTTCTGCTGGCGTTGTGTCCGACGAACATCGATCCTTCGTCTTTGAGTGTCATGGTG
GCTTTTGCTGTGGGCGGCTTGCTGGGTGATACGCTCTTTCATCTGCTGCCGGAGATCTTTTTGGGTGAGGATGAC
GATGAGAGGGCGCGGTTGGTGCTCGTGGAGCCGAATCGCAATTTGCTGTTGGGGCTTGGCATCTTGGTCGGCTTC
ATGACTTTTGTTGCTATGGATAAGGGGCTGCGCATCGCTACGGGAGGTTCGGGACATGATCATGGTCACGGACAT
GAACGTGGCCATGCTGAGCCGCGACACGAGGTTGCATCGTCGACGACGACGGGCGCAGAGGCCGCGGCGATACAG
GTCAAGTCGAGGAAGAAAAAGGGAGAGCGAGAGGTCGGGGCCGCTGAGCCGACGGATAAGCAGGCTGTCAATCCC
AGTGTGAAGCTGGGCGGTTACCTCAACCTCATGTACGTGCCCCCTTAATTGTGCCGAGGAGCAAGCTGCCTTGGA
CTGACGAGGGTGCAGCGCCGACTTTACGCACAACATCACCGACGGGCTGGCCATGTCTGCCAGCTTCTACGCGTC
GCCGACGGTGGGCGCCACCACCACCATGGCCGTCTTCTTCCACGAGATCCCGCACGAGGTGGGCGACTTTGCGCT
GCTGGTCCAGTCGGGCTTCTCCAAGCGCGCGGCCATGGCGTCTCAGTTCGTAACGGCTGTCGGCGCCCTGCTGGG
GACCCTCATTGGCATTGCCGTGCAGGAGATGGGAGGAAGTGGTGGTGGCGGTGGTGGCGGTGAGGGTGCTGCAGC
CCTGCCACGCGACGGCGGCATTTGGGGGACGAGCCTCGTGAGTTTTCCTTTTTTTTTTTTGCTCCCCCTTCTTTC
GTCATGACGACGGAGGACGACCACGTCTGACGCTGTGGAACGCAGAGCTGGGGGGATATGCTGCTGCCCTTTACG
GCCGGCACCTTTTTGTACGTCGGCACCGTCGCCGTCATCCCCGAGCTGTTGGAGACGGGGCCGAGGAAGATGGAG
GAGCTTCGCAAGACGATGGTGCAGTTTGCCGCCGTGGCCGTGGGCGCGGGAGTGATGCTATACATTTCGTGGCAT
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail