Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04005
Gene name
Locationscaffold_04:605925..607432
Strand+
Gene length (bp)1507
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00117 GATase Glutamine amidotransferase class-I 6.1E-46 241 416
PF00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain 1.1E-44 64 196

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2248 0.1065 0.1099 0.0603 0.9081 0.14 0.0423 0.0755 0.1299 0.0457

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2721
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1505
Ophiocordyceps australis map64 (Brazil) OphauB2|4209
Ophiocordyceps camponoti-floridani Ophcf2|04005 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2834
Ophiocordyceps kimflemingae Ophio5|338
Ophiocordyceps subramaniannii Hirsu2|4277

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04005
MFTRLAIPFAKPAVNLATFSRPSALSVRFLTRNVATAGTTGRNMPSQGLRATAPVASLPATFTIRDGPVFQGKAF
GANSNISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGVPSNGRDAYNLLKYFESPHIQCAGVVVSDVA
LNYSHWTAVESLGEWCAREGVPAISGVDTRAIVTYLREQGSSLARISIGDEYDADEDESFVDPGQINLVKRVSTK
APFAVESPNASYHVALIDCGVKENIIRGLVSRGASVTVLPHDYPIHKVAQHFDGVFISNGPGDPTHCQSTVYNLA
RLIETSSIPIMGICLGHQLLALAVGARTIKLKYGNRAHNIPALDLTTGQCHITSQNHGYAVDASTLPSDFREYFV
NLNDGSNEGMTHKTRPIFSTQFHPEAKGGPMDSAYLFDKYLHNIQLAKKAQRVYKDNRPSKFVLDILSKERVGVD
PVPLAGVAA*
Coding >Ophcf2|04005
ATGTTTACCCGACTGGCCATACCCTTCGCCAAGCCGGCTGTCAACCTGGCCACCTTTTCCCGCCCATCCGCCTTG
TCCGTCCGCTTCCTGACTCGCAATGTCGCTACCGCCGGCACCACCGGCAGGAATATGCCCTCGCAGGGTCTCCGA
GCTACCGCTCCCGTGGCGTCTTTGCCTGCCACCTTCACCATCAGGGACGGCCCGGTGTTCCAGGGCAAGGCTTTT
GGAGCCAACTCCAACATCTCGGGTGAAGCCGTCTTCACCACCTCGCTCGTCGGCTATCCCGAGTCCATGACGGAT
CCCTCTTATCGCGGCCAGATCCTCGTCTTCACTCAGCCGCTCATCGGCAACTACGGCGTCCCCTCCAACGGCCGA
GATGCCTACAACCTTCTGAAATACTTCGAGTCCCCCCATATCCAGTGCGCCGGCGTCGTCGTCTCCGACGTCGCC
CTCAACTACAGCCACTGGACCGCCGTAGAGAGTCTGGGCGAATGGTGCGCTCGCGAGGGCGTCCCCGCCATCTCT
GGCGTCGACACTCGCGCCATCGTCACCTACCTCCGTGAACAGGGCTCCTCCCTCGCCCGCATATCAATCGGTGAC
GAGTACGACGCCGACGAGGACGAAAGCTTCGTCGATCCTGGACAGATCAACCTGGTCAAGCGCGTCAGCACAAAG
GCCCCCTTCGCCGTCGAATCGCCCAACGCCTCCTACCACGTGGCCCTCATCGACTGTGGCGTCAAGGAGAACATC
ATCCGCGGTCTCGTCAGCCGCGGCGCCTCCGTCACCGTCCTCCCTCACGACTATCCCATCCACAAGGTGGCCCAG
CACTTCGACGGCGTCTTCATCTCCAACGGGCCCGGCGACCCGACTCACTGCCAGTCTACCGTCTACAACCTGGCC
CGCCTGATCGAGACGTCGTCCATCCCCATCATGGGCATCTGCCTCGGCCACCAGCTGCTCGCCCTGGCCGTCGGT
GCCCGCACCATCAAGCTCAAGTACGGCAATCGCGCTCACAACATCCCCGCCCTCGACCTCACGACGGGCCAATGC
CACATTACGAGCCAGAACCACGGATACGCCGTCGACGCCAGCACCCTCCCCAGCGACTTCCGGGAGTATTTTGTC
AATCTCAACGACGGCAGCAACGAGGGCATGACACACAAAACACGCCCAATCTTCTCAACCCAGTTCCACCCCGAG
GCAAAAGGCGGACCCATGGACAGCGCCTACCTCTTCGACAAGTACCTCCACAACATCCAGCTCGCCAAGAAGGCC
CAGCGCGTCTACAAGGATAACCGCCCCAGCAAGTTCGTGCTCGACATCCTGAGTAAGGAGCGCGTCGGCGTCGAT
CCTGTGCCTCTGGCTGGCGTTGCTGCTTGA
Transcript >Ophcf2|04005
ATGTTTACCCGACTGGCCATACCCTTCGCCAAGCCGGCTGTCAACCTGGCCACCTTTTCCCGCCCATCCGCCTTG
TCCGTCCGCTTCCTGACTCGCAATGTCGCTACCGCCGGCACCACCGGCAGGAATATGCCCTCGCAGGGTCTCCGA
GCTACCGCTCCCGTGGCGTCTTTGCCTGCCACCTTCACCATCAGGGACGGCCCGGTGTTCCAGGGCAAGGCTTTT
GGAGCCAACTCCAACATCTCGGGTGAAGCCGTCTTCACCACCTCGCTCGTCGGCTATCCCGAGTCCATGACGGAT
CCCTCTTATCGCGGCCAGATCCTCGTCTTCACTCAGCCGCTCATCGGCAACTACGGCGTCCCCTCCAACGGCCGA
GATGCCTACAACCTTCTGAAATACTTCGAGTCCCCCCATATCCAGTGCGCCGGCGTCGTCGTCTCCGACGTCGCC
CTCAACTACAGCCACTGGACCGCCGTAGAGAGTCTGGGCGAATGGTGCGCTCGCGAGGGCGTCCCCGCCATCTCT
GGCGTCGACACTCGCGCCATCGTCACCTACCTCCGTGAACAGGGCTCCTCCCTCGCCCGCATATCAATCGGTGAC
GAGTACGACGCCGACGAGGACGAAAGCTTCGTCGATCCTGGACAGATCAACCTGGTCAAGCGCGTCAGCACAAAG
GCCCCCTTCGCCGTCGAATCGCCCAACGCCTCCTACCACGTGGCCCTCATCGACTGTGGCGTCAAGGAGAACATC
ATCCGCGGTCTCGTCAGCCGCGGCGCCTCCGTCACCGTCCTCCCTCACGACTATCCCATCCACAAGGTGGCCCAG
CACTTCGACGGCGTCTTCATCTCCAACGGGCCCGGCGACCCGACTCACTGCCAGTCTACCGTCTACAACCTGGCC
CGCCTGATCGAGACGTCGTCCATCCCCATCATGGGCATCTGCCTCGGCCACCAGCTGCTCGCCCTGGCCGTCGGT
GCCCGCACCATCAAGCTCAAGTACGGCAATCGCGCTCACAACATCCCCGCCCTCGACCTCACGACGGGCCAATGC
CACATTACGAGCCAGAACCACGGATACGCCGTCGACGCCAGCACCCTCCCCAGCGACTTCCGGGAGTATTTTGTC
AATCTCAACGACGGCAGCAACGAGGGCATGACACACAAAACACGCCCAATCTTCTCAACCCAGTTCCACCCCGAG
GCAAAAGGCGGACCCATGGACAGCGCCTACCTCTTCGACAAGTACCTCCACAACATCCAGCTCGCCAAGAAGGCC
CAGCGCGTCTACAAGGATAACCGCCCCAGCAAGTTCGTGCTCGACATCCTGAGTAAGGAGCGCGTCGGCGTCGAT
CCTGTGCCTCTGGCTGGCGTTGCTGCTTGA
Gene >Ophcf2|04005
ATGTTTACCCGACTGGCCATACCCTTCGCCAAGCCGGCTGTCAACCTGGCCACCTTTTCCCGCCCATCCGCCTTG
TCCGTCCGCTTCCTGACTCGCAATGTCGCTACCGCCGGCACCACCGGCAGGAATATGCCCTCGCAGGGTCTCCGA
GCTACCGCTCCCGTGGCGTCTTTGCCTGCCACCTTCACCATCAGGGTGAGACCCTAAGGGAAAAAAAAAAAAGAA
AAATAGCTCCGGGCTCGCCCGCTAACAGCGCTTCAGGACGGCCCGGTGTTCCAGGGCAAGGCTTTTGGAGCCAAC
TCCAACATCTCGGGTGAAGCCGTCTTCACCACCTCGCTCGTCGGCTATCCCGAGTCCATGACGGATCCCTCTTAT
CGCGGCCAGATCCTCGTCTTCACTCAGCCGCTCATCGGCAACTACGGCGTCCCCTCCAACGGCCGAGATGCCTAC
AACCTTCTGAAATACTTCGAGTCCCCCCATATCCAGTGCGCCGGCGTCGTCGTCTCCGACGTCGCCCTCAACTAC
AGCCACTGGACCGCCGTAGAGAGTCTGGGCGAATGGTGCGCTCGCGAGGGCGTCCCCGCCATCTCTGGCGTCGAC
ACTCGCGCCATCGTCACCTACCTCCGTGAACAGGGCTCCTCCCTCGCCCGCATATCAATCGGTGACGAGTACGAC
GCCGACGAGGACGAAAGCTTCGTCGATCCTGGACAGATCAACCTGGTCAAGCGCGTCAGCACAAAGGCCCCCTTC
GCCGTCGAATCGCCCAACGCCTCCTACCACGTGGCCCTCATCGACTGTGGCGTCAAGGAGAACATCATCCGCGGT
CTCGTCAGCCGCGGCGCCTCCGTCACCGTCCTCCCTCACGACTATCCCATCCACAAGGTGGCCCAGCACTTCGAC
GGCGTCTTCATCTCCAACGGGCCCGGCGACCCGACTCACTGCCAGTCTACCGTCTACAACCTGGCCCGCCTGATC
GAGACGTCGTCCATCCCCATCATGGGCATCTGCCTCGGCCACCAGCTGCTCGCCCTGGCCGTCGGTGCCCGCACC
ATCAAGCTCAAGTACGGCAATCGCGCTCACAACATCCCCGCCCTCGACCTCACGACGGGCCAATGCCACATTACG
AGCCAGAACCACGGATACGCCGTCGACGCCAGCACCCTCCCCAGCGACTTCCGGGAGTATTTTGTCAATCTCAAC
GACGGCAGCAACGAGGGTAAGTGTTTTCCTCTCCGATTCAGTCCGAAACGGCGAATCAGCTTATGACCATGACCA
AGGCATGACACACAAAACACGCCCAATCTTCTCAACCCAGTTCCACCCCGAGGCAAAAGGCGGACCCATGGACAG
CGCCTACCTCTTCGACAAGTACCTCCACAACATCCAGCTCGCCAAGAAGGCCCAGCGCGTCTACAAGGATAACCG
CCCCAGCAAGTTCGTGCTCGACATCCTGAGTAAGGAGCGCGTCGGCGTCGATCCTGTGCCTCTGGCTGGCGTTGC
TGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail