Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03994
Gene name
Locationscaffold_04:573422..574388
Strand-
Gene length (bp)966
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07574 SMC_Nse1 Nse1 non-SMC component of SMC5-6 complex 1.6E-66 14 202
PF08746 zf-RING-like RING-like domain 4.0E-12 226 268

GO

GO Term Description Terminal node
GO:0006281 DNA repair Yes
GO:0030915 Smc5-Smc6 complex Yes
GO:0050896 response to stimulus No
GO:0044237 cellular metabolic process No
GO:0106068 SUMO ligase complex No
GO:1990234 transferase complex No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0044260 cellular macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006950 response to stress No
GO:0008150 biological_process No
GO:1902494 catalytic complex No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4317 0.8167 0.0336 0.0294 0.1123 0.002 0.0398 0.1343 0.1087 0.0039

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1274
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2451
Ophiocordyceps australis map64 (Brazil) OphauB2|4199
Ophiocordyceps camponoti-floridani Ophcf2|03994 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3999
Ophiocordyceps kimflemingae Ophio5|4234
Ophiocordyceps subramaniannii Hirsu2|10551

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03994
MEENLARRGYDHTHRAFLQALLARGTVTFEESQSILAAIVNVKNGEDGAMNPEQVSQDLFESYLNLVSEAASMFD
YEIRSTVHQLSKQRVYALVNTNSDPQTQLATTYNAEELAFIKRLLDGIFDKYNRPRMEVLAITEMQAIKFARPNR
RPSQAGQTEPSTDKGLKHSEVERVLAGLVDGGWLEKSRSGFYSVTPRALLELRPWLIDMYNDADAGQDDWQRIKF
CEACKDIVTAGLRCADPACTFRLHEICQEAFWRVRRTTSCSKCEREWTGANFVGEKAVTSTEAYQRGRRRGGGRR
STLADQVMENQGLGDGSDGDQ*
Coding >Ophcf2|03994
ATGGAAGAGAATCTCGCCAGGCGCGGCTACGACCACACCCACCGCGCGTTCCTGCAGGCGCTCCTGGCCCGCGGC
ACGGTGACATTCGAAGAGTCGCAATCGATACTGGCGGCCATCGTCAACGTCAAGAACGGGGAGGATGGAGCCATG
AACCCGGAACAGGTCAGCCAGGACCTCTTCGAATCATACCTGAACCTAGTCTCCGAGGCGGCCTCCATGTTCGAC
TACGAGATCCGCAGCACGGTGCACCAGCTCAGCAAGCAACGAGTCTACGCGCTCGTCAACACCAATTCCGACCCC
CAGACACAACTAGCGACGACGTACAACGCAGAAGAGCTGGCCTTTATTAAACGCCTTCTCGATGGCATCTTTGAC
AAATACAACCGACCGCGGATGGAGGTGCTGGCAATCACAGAGATGCAAGCCATCAAATTCGCCAGGCCGAACCGG
AGGCCTAGCCAGGCGGGCCAGACCGAGCCGTCGACAGACAAGGGCCTGAAGCATAGCGAGGTAGAGCGGGTCCTC
GCCGGTCTGGTGGACGGCGGCTGGCTGGAGAAGAGCAGGAGTGGCTTCTACTCGGTGACGCCGCGAGCGCTGCTG
GAGCTGCGGCCATGGCTGATAGACATGTACAACGACGCCGACGCGGGCCAGGACGACTGGCAGCGCATCAAGTTC
TGCGAGGCCTGCAAGGACATCGTCACGGCGGGCTTGCGCTGCGCCGACCCGGCCTGTACCTTTCGCCTGCACGAA
ATCTGCCAGGAGGCCTTTTGGAGGGTGCGTCGGACGACGAGCTGTTCCAAGTGCGAGCGCGAGTGGACGGGCGCC
AACTTCGTCGGCGAGAAGGCCGTCACCTCGACCGAGGCCTATCAGAGGGGACGCAGGCGCGGGGGCGGCAGGAGG
AGCACGCTGGCTGACCAGGTCATGGAAAATCAGGGACTCGGAGACGGGAGCGACGGCGATCAATAG
Transcript >Ophcf2|03994
ATGGAAGAGAATCTCGCCAGGCGCGGCTACGACCACACCCACCGCGCGTTCCTGCAGGCGCTCCTGGCCCGCGGC
ACGGTGACATTCGAAGAGTCGCAATCGATACTGGCGGCCATCGTCAACGTCAAGAACGGGGAGGATGGAGCCATG
AACCCGGAACAGGTCAGCCAGGACCTCTTCGAATCATACCTGAACCTAGTCTCCGAGGCGGCCTCCATGTTCGAC
TACGAGATCCGCAGCACGGTGCACCAGCTCAGCAAGCAACGAGTCTACGCGCTCGTCAACACCAATTCCGACCCC
CAGACACAACTAGCGACGACGTACAACGCAGAAGAGCTGGCCTTTATTAAACGCCTTCTCGATGGCATCTTTGAC
AAATACAACCGACCGCGGATGGAGGTGCTGGCAATCACAGAGATGCAAGCCATCAAATTCGCCAGGCCGAACCGG
AGGCCTAGCCAGGCGGGCCAGACCGAGCCGTCGACAGACAAGGGCCTGAAGCATAGCGAGGTAGAGCGGGTCCTC
GCCGGTCTGGTGGACGGCGGCTGGCTGGAGAAGAGCAGGAGTGGCTTCTACTCGGTGACGCCGCGAGCGCTGCTG
GAGCTGCGGCCATGGCTGATAGACATGTACAACGACGCCGACGCGGGCCAGGACGACTGGCAGCGCATCAAGTTC
TGCGAGGCCTGCAAGGACATCGTCACGGCGGGCTTGCGCTGCGCCGACCCGGCCTGTACCTTTCGCCTGCACGAA
ATCTGCCAGGAGGCCTTTTGGAGGGTGCGTCGGACGACGAGCTGTTCCAAGTGCGAGCGCGAGTGGACGGGCGCC
AACTTCGTCGGCGAGAAGGCCGTCACCTCGACCGAGGCCTATCAGAGGGGACGCAGGCGCGGGGGCGGCAGGAGG
AGCACGCTGGCTGACCAGGTCATGGAAAATCAGGGACTCGGAGACGGGAGCGACGGCGATCAATAG
Gene >Ophcf2|03994
ATGGAAGAGAATCTCGCCAGGCGCGGCTACGACCACACCCACCGCGCGTTCCTGCAGGCGCTCCTGGCCCGCGGC
ACGGTGACATTCGAAGAGTCGCAATCGATACTGGCGGCCATCGTCAACGTCAAGAACGGGGAGGATGGAGCCATG
AACCCGGAACAGGTCAGCCAGGACCTCTTCGAATCATACCTGAACCTAGTCTCCGAGGCGGCCTCCATGTTCGAC
TACGAGATCCGCAGCACGGTGCACCAGCTCAGCAAGCAACGAGTCTACGCGCTCGTCAACACCAATTCCGACCCC
CAGACACAACTAGCGACGACGTACAACGCAGAAGAGCTGGCCTTTATTAAACGCCTTCTCGATGGCATCTTTGAC
AAATACAACCGACCGCGGATGGAGGTGCTGGCAATCACAGAGATGCAAGCCATCAAATTCGCCAGGCCGAACCGG
AGGCCTAGCCAGGCGGGCCAGACCGAGCCGTCGACAGACAAGGGCCTGAAGCATAGCGAGGTAGAGCGGGTCCTC
GCCGGTCTGGTGGACGGCGGCTGGCTGGAGAAGAGCAGGAGTGGCTTCTACTCGGTGACGCCGCGAGCGCTGCTG
GAGCTGCGGCCATGGCTGATAGACATGTACAACGACGCCGACGCGGGCCAGGACGACTGGCAGCGCATCAAGTTC
TGCGAGGCCTGCAAGGACATCGTCACGGCGGGCTTGCGCTGCGCCGACCCGGCCTGTACCTTTCGCCTGCACGAA
ATCTGCCAGGAGGCCTTTTGGAGGGTGCGTCGGACGACGAGCTGTTCCAAGTGCGAGCGCGAGTGGACGGGCGCC
AACTTCGTCGGCGAGAAGGCCGTCACCTCGACCGAGGCCTATCAGAGGGGACGCAGGCGCGGGGGCGGCAGGAGG
AGCACGCTGGCTGACCAGGTCATGGAAAATCAGGGACTCGGAGACGGGAGCGACGGCGATCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail