Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03989
Gene name
Locationscaffold_04:563738..565409
Strand-
Gene length (bp)1671
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-25 61 423

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 114 136 22
2 151 173 22
3 186 208 22
4 213 235 22
5 279 301 22
6 311 333 22
7 346 368 22
8 372 394 22
9 407 429 22
10 434 456 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 31.88 17.20 46.55
Alive In ants, during behavior modification 82.78 42.81 122.74
Dead In ants, recently dead 97.50 55.05 139.95

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.379519 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03989
MAAVVNSRTASPSFARTGGELDFDSASESEIEIPSHDAIYTPQQEKQVLDLLDRKLVLFIGLLYMLSFLDRSNIG
NARIAGMEADLQTSPPLSTWYDWCLTSFYATYMASAWLALIWRLVPAHVLVTVVVLAWGVAASVQAVVPSYPYLV
ALRALLAVGEAGFTGVPLYLSWFYKREELALRTGYFISAAPLASSFASALAWLILRFASLSPIAPWRLLFLAEGI
PSVLASVSAWTRIPDSARKAPFLTARQRRIAHLRLPPDTPPPTRQTNVLVDPIAWTAATMLLLANMAYASLPVFL
PLLVEDMGHGPVAAQALSAPPFLVSFIAVLVTARFSDRIRDRTAPLVAHAVASAGGYALLAAAPLIHLPPLLRYL
ALFPAAAGFFCVVTLIITWNINNQPGRHRQGLAFALMQFVGQCGPLIGTRLYPARHAPFYTPGMLVCACAMGVVA
VLGLVLRRLLRSHNRNMDRADDEKLTEERERLVGEGETMASTASKSGSTTDTTARFRYML*
Coding >Ophcf2|03989
ATGGCGGCGGTGGTGAATTCGCGGACGGCGAGCCCTTCGTTTGCGCGGACGGGTGGTGAGCTGGACTTTGACTCG
GCTTCTGAGTCGGAGATTGAGATTCCCAGCCACGATGCCATCTATACGCCTCAGCAGGAGAAGCAGGTCCTCGAC
CTCCTCGACCGCAAACTCGTCCTCTTCATCGGCCTCCTCTACATGCTCAGCTTCCTCGACCGCTCCAACATAGGC
AACGCCCGCATAGCCGGCATGGAAGCCGATCTCCAAACCTCCCCCCCGCTCTCGACCTGGTACGACTGGTGTCTG
ACCTCGTTCTACGCAACGTACATGGCCAGCGCCTGGCTCGCCCTCATCTGGCGCCTCGTTCCCGCGCACGTGCTC
GTCACCGTGGTTGTGCTGGCGTGGGGGGTGGCTGCTTCGGTGCAGGCTGTTGTGCCGTCGTACCCGTATCTTGTT
GCCTTGCGTGCTTTGCTGGCTGTTGGGGAGGCGGGATTTACGGGCGTGCCGCTGTATCTCTCTTGGTTTTATAAG
AGGGAAGAGTTGGCTTTGCGGACTGGATACTTTATCTCTGCCGCGCCTCTGGCCTCGAGCTTCGCCTCAGCCCTC
GCCTGGCTAATCCTCCGCTTCGCATCCCTCAGCCCCATCGCCCCCTGGCGCCTCCTCTTCCTAGCAGAAGGCATC
CCCTCAGTCCTCGCCTCCGTCTCGGCCTGGACCAGGATCCCAGACTCGGCCCGAAAAGCCCCCTTCCTAACGGCC
CGTCAACGGCGCATCGCCCACCTCCGTCTCCCCCCCGACACGCCGCCTCCGACACGACAGACCAACGTGCTGGTA
GATCCCATCGCCTGGACGGCCGCCACGATGCTCCTCCTCGCAAACATGGCCTACGCTTCTCTGCCCGTCTTTCTC
CCCCTCCTTGTCGAGGACATGGGTCACGGCCCTGTTGCCGCTCAAGCGCTCTCGGCGCCTCCTTTTCTCGTTTCC
TTCATTGCCGTTCTCGTCACTGCCCGTTTCTCGGACCGGATTCGAGACCGGACGGCTCCGCTTGTTGCTCACGCT
GTGGCTTCGGCTGGGGGCTATGCTCTCCTCGCTGCCGCGCCGCTGATTCATCTCCCGCCGTTGCTGCGTTATCTC
GCCCTCTTTCCCGCTGCTGCTGGCTTCTTCTGCGTCGTCACCCTCATCATCACCTGGAACATCAATAACCAGCCC
GGACGACATCGTCAGGGCCTCGCCTTTGCCCTCATGCAGTTCGTCGGTCAGTGCGGGCCTCTTATAGGCACTCGT
CTCTATCCCGCCCGTCACGCCCCCTTTTACACGCCCGGCATGTTGGTTTGTGCCTGTGCCATGGGTGTCGTCGCC
GTATTGGGTCTGGTCTTGCGTCGTCTACTGCGCAGTCACAACCGGAACATGGATAGAGCCGATGACGAGAAGCTC
ACTGAAGAACGGGAGCGGCTGGTCGGCGAGGGGGAGACCATGGCGTCTACGGCGTCCAAGTCTGGGAGCACCACT
GACACGACAGCCAGGTTCCGGTACATGTTGTAG
Transcript >Ophcf2|03989
ATGGCGGCGGTGGTGAATTCGCGGACGGCGAGCCCTTCGTTTGCGCGGACGGGTGGTGAGCTGGACTTTGACTCG
GCTTCTGAGTCGGAGATTGAGATTCCCAGCCACGATGCCATCTATACGCCTCAGCAGGAGAAGCAGGTCCTCGAC
CTCCTCGACCGCAAACTCGTCCTCTTCATCGGCCTCCTCTACATGCTCAGCTTCCTCGACCGCTCCAACATAGGC
AACGCCCGCATAGCCGGCATGGAAGCCGATCTCCAAACCTCCCCCCCGCTCTCGACCTGGTACGACTGGTGTCTG
ACCTCGTTCTACGCAACGTACATGGCCAGCGCCTGGCTCGCCCTCATCTGGCGCCTCGTTCCCGCGCACGTGCTC
GTCACCGTGGTTGTGCTGGCGTGGGGGGTGGCTGCTTCGGTGCAGGCTGTTGTGCCGTCGTACCCGTATCTTGTT
GCCTTGCGTGCTTTGCTGGCTGTTGGGGAGGCGGGATTTACGGGCGTGCCGCTGTATCTCTCTTGGTTTTATAAG
AGGGAAGAGTTGGCTTTGCGGACTGGATACTTTATCTCTGCCGCGCCTCTGGCCTCGAGCTTCGCCTCAGCCCTC
GCCTGGCTAATCCTCCGCTTCGCATCCCTCAGCCCCATCGCCCCCTGGCGCCTCCTCTTCCTAGCAGAAGGCATC
CCCTCAGTCCTCGCCTCCGTCTCGGCCTGGACCAGGATCCCAGACTCGGCCCGAAAAGCCCCCTTCCTAACGGCC
CGTCAACGGCGCATCGCCCACCTCCGTCTCCCCCCCGACACGCCGCCTCCGACACGACAGACCAACGTGCTGGTA
GATCCCATCGCCTGGACGGCCGCCACGATGCTCCTCCTCGCAAACATGGCCTACGCTTCTCTGCCCGTCTTTCTC
CCCCTCCTTGTCGAGGACATGGGTCACGGCCCTGTTGCCGCTCAAGCGCTCTCGGCGCCTCCTTTTCTCGTTTCC
TTCATTGCCGTTCTCGTCACTGCCCGTTTCTCGGACCGGATTCGAGACCGGACGGCTCCGCTTGTTGCTCACGCT
GTGGCTTCGGCTGGGGGCTATGCTCTCCTCGCTGCCGCGCCGCTGATTCATCTCCCGCCGTTGCTGCGTTATCTC
GCCCTCTTTCCCGCTGCTGCTGGCTTCTTCTGCGTCGTCACCCTCATCATCACCTGGAACATCAATAACCAGCCC
GGACGACATCGTCAGGGCCTCGCCTTTGCCCTCATGCAGTTCGTCGGTCAGTGCGGGCCTCTTATAGGCACTCGT
CTCTATCCCGCCCGTCACGCCCCCTTTTACACGCCCGGCATGTTGGTTTGTGCCTGTGCCATGGGTGTCGTCGCC
GTATTGGGTCTGGTCTTGCGTCGTCTACTGCGCAGTCACAACCGGAACATGGATAGAGCCGATGACGAGAAGCTC
ACTGAAGAACGGGAGCGGCTGGTCGGCGAGGGGGAGACCATGGCGTCTACGGCGTCCAAGTCTGGGAGCACCACT
GACACGACAGCCAGGTTCCGGTACATGTTGTAG
Gene >Ophcf2|03989
ATGGCGGCGGTGGTGAATTCGCGGACGGCGAGCCCTTCGTTTGCGCGGACGGGTGGTGAGCTGGACTTTGACTCG
GCTTCTGAGTCGGAGATTGAGATTCCCAGCCACGATGCCATCTATACGCCTCAGCAGGAGAAGCAGGTCCTCGAC
CTCCTCGACCGCAAACTCGTCCTCTTCATCGGCCTCCTCTACATGCTCAGCTTCCTCGACCGCTCCAGTAAGCCC
CAAATCCGGCTTCCACTCCCCCATCGAAGGGTCCCTCTAACACAACGACCCCCGAACCCCAAGACATAGGCAACG
CCCGCATAGCCGGCATGGAAGCCGATCTCCAAACCTCCCCCCCGCTCTCGACCTGGTACGACTGGTGTCTGACCT
CGTTCTACGCAACGTACATGGCCAGCGCCTGGCTCGCCCTCATCTGGCGCCTCGTTCCCGCGCACGTGCTCGTCA
CCGTGGTTGTGCTGGCGTGGGGGGTGGCTGCTTCGGTGCAGGCTGTTGTGCCGTCGTACCCGTATCTTGTTGCCT
TGCGTGCTTTGCTGGCTGTTGGGGAGGCGGGATTTACGGGCGTGCCGCTGTATCTCTCTTGGTTTTATAAGAGGG
AAGAGTTGGCTTTGCGGACTGGATACTTTATCTCTGGTGAGTTGATCCGGAACAAACAAGAGAGAGAGAGAGAGA
GAGAGAGAGAGAAACTGACGATATAAAGCCGCGCCTCTGGCCTCGAGCTTCGCCTCAGCCCTCGCCTGGCTAATC
CTCCGCTTCGCATCCCTCAGCCCCATCGCCCCCTGGCGCCTCCTCTTCCTAGCAGAAGGCATCCCCTCAGTCCTC
GCCTCCGTCTCGGCCTGGACCAGGATCCCAGACTCGGCCCGAAAAGCCCCCTTCCTAACGGCCCGTCAACGGCGC
ATCGCCCACCTCCGTCTCCCCCCCGACACGCCGCCTCCGACACGACAGACCAACGTGCTGGTAGATCCCATCGCC
TGGACGGCCGCCACGATGCTCCTCCTCGCAAACATGGCCTACGCTTCTCTGCCCGTCTTTCTCCCCCTCCTTGTC
GAGGACATGGGTCACGGCCCTGTTGCCGCTCAAGCGCTCTCGGCGCCTCCTTTTCTCGTTTCCTTCATTGCCGTT
CTCGTCACTGCCCGTTTCTCGGACCGGATTCGAGACCGGACGGCTCCGCTTGTTGCTCACGCTGTGGCTTCGGCT
GGGGGCTATGCTCTCCTCGCTGCCGCGCCGCTGATTCATCTCCCGCCGTTGCTGCGTTATCTCGCCCTCTTTCCC
GCTGCTGCTGGCTTCTTCTGCGTCGTCACCCTCATCATCACCTGGAACATCAATAACCAGCCCGGACGACATCGT
CAGGGCCTCGCCTTTGCCCTCATGCAGTTCGTCGGTCAGTGCGGGCCTCTTATAGGCACTCGTCTCTATCCCGCC
CGTCACGCCCCCTTTTACACGCCCGGCATGTTGGTTTGTGCCTGTGCCATGGGTGTCGTCGCCGTATTGGGTCTG
GTCTTGCGTCGTCTACTGCGCAGTCACAACCGGAACATGGATAGAGCCGATGACGAGAAGCTCACTGAAGAACGG
GAGCGGCTGGTCGGCGAGGGGGAGACCATGGCGTCTACGGCGTCCAAGTCTGGGAGCACCACTGACACGACAGCC
AGGTTCCGGTACATGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail