Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03985
Gene name
Locationscaffold_04:553877..557360
Strand+
Gene length (bp)3483
Transcript length (bp)3483
Coding sequence length (bp)3483
Protein length (aa) 1161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 5.5E-72 69 543
PF07993 NAD_binding_4 Male sterility protein 1.9E-54 790 1034
PF00550 PP-binding Phosphopantetheine attachment site 7.8E-09 680 734
PF01370 Epimerase NAD dependent epimerase/dehydratase family 5.5E-06 788 1043

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7235 0.2992 0.0734 0.1112 0.1238 0.1856 0.0701 0.2256 0.2046 0.0371

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 15 NRPS-like

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 6.05 2.84 9.27
Alive In ants, during behavior modification 0.28 0.00 0.56
Dead In ants, recently dead 0.48 0.03 0.92

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 1.000000 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4864
Ophiocordyceps australis map64 (Brazil) OphauB2|263
Ophiocordyceps australis map64 (Brazil) OphauB2|352
Ophiocordyceps camponoti-floridani Ophcf2|03985 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1885
Ophiocordyceps kimflemingae Ophio5|1347
Ophiocordyceps kimflemingae Ophio5|1348
Ophiocordyceps kimflemingae Ophio5|7675
Ophiocordyceps subramaniannii Hirsu2|2141
Ophiocordyceps subramaniannii Hirsu2|4799
Ophiocordyceps subramaniannii Hirsu2|7001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03985
MALNAENLSHDQMSMAADIGPVMPSLDPLLAESLQDPNPPSSAPEETMAGEGGYEDVAVSGLGLAELFHRQTVKR
AASVAVVDGCRTLTYRQLDARAVRLARVLNRDGGAAGLREEVVGIVVRHGVADVVAQMAVLYAGGSCAPMDPTLV
DHQIEARLKRLGARFVLVDGENGKRAFPFDTVCIDDEGDDTDEEEEVKSWPDLTPGATTPEIKPRPTPSAEAVKT
SELLLTPDLAALALSGAPVKAPLSPKQRLLREVTPASTPGLTSGPTRSGAETPVTYPVPTGPEHRTHLIHTSGTT
GEAKAVQIAGRSVIHVAHHVPLEPLRSSDVVAHVNNSSFDVSLIDVWAPLLRGASIAVLSKAVLLDPPAMEREIE
RLGVTVMATTTALLNLVAFTHPTAFSGLRICFIGGEQANVGAIKVVLEKGPPGMLVNAYGPTECCVFCLARVVRH
EDVEAGSVSIGTAIGRNEALVVDDEGRLSEEGELWIAGPGLSPGYANHPEKTEAAFPVLADGRRVYRTGDIVRRR
QDGQMDYIGRRDHQVKVRGFRIELGAVEAALLQTALFSEAVALKMDIPRLGAGSILVAYVVPVHVSEPPVVSEAL
AKVRHLLPEYMVPQLEMVERLPLSSHAKVDRNKLAELFASRWATTMTTTTTTGEEEGKDKINKVFDAASRPGEVR
DAMAHLWESILAVPSRAFGDSDDFISLGGSSLQASLLVSQIRQTFGLEIPLLTLYRDFSLGAVSSVVSAGLVGSV
PAPPDERETWIADGLIGDALPIPTGQVIDWRAEGEGRVFVTGATGFVGAFLMADLMVDEKVERVCCLVRAADAVE
GLGRIRAGMEKYGLWKDDFVERLLVVTGLLEDENLGLGVDGFEAVASWASVIFHLGARVNYTQPYGLHRAANTLG
TLNVVRLSTAGHRLKPLHYVSSISCFGPTGLMTGAKLVREDEPLLRHIDALPLDHGYAQSQWVAERLVGRLIERG
FPIAVYRPGFVTGHSRTGACNRDDFVSRLIEACCEMGCYPLLPNQRKEFVPVDYVCAAILHIAASPTSPGKAFHI
VPPSREASVDMDATMDLVGRARNTPLRGVPYGEWVERLAVVAPLRLLPLQPMLAEKIRGGRTRWELYENMPVYDT
SNTDAALADYPGGLVLPELDEGLMKRYIDFIEGSK*
Coding >Ophcf2|03985
ATGGCCTTGAACGCTGAGAATCTGTCTCACGACCAGATGTCCATGGCTGCTGATATCGGTCCCGTCATGCCGAGC
CTCGACCCCCTACTAGCCGAATCCCTCCAAGACCCGAACCCCCCATCGTCAGCCCCAGAAGAAACCATGGCGGGA
GAAGGAGGCTATGAAGACGTGGCTGTCTCGGGACTCGGCCTGGCAGAGCTCTTCCACAGGCAGACGGTCAAGAGA
GCGGCTTCGGTGGCCGTCGTCGACGGATGCCGCACGCTGACGTACCGCCAGCTCGATGCCCGTGCCGTCCGTCTG
GCCCGTGTCTTGAACCGGGACGGAGGTGCGGCTGGGTTGAGGGAGGAGGTCGTCGGTATCGTGGTGAGGCATGGC
GTCGCCGACGTGGTGGCTCAGATGGCAGTCTTGTATGCTGGCGGGAGCTGTGCGCCCATGGATCCTACGCTCGTC
GATCATCAGATCGAGGCGAGGTTGAAGAGGTTGGGTGCCAGGTTCGTGCTGGTCGACGGGGAGAATGGGAAGAGG
GCCTTTCCGTTTGATACGGTCTGCATCGACGACGAGGGTGACGATACGGACGAGGAGGAAGAAGTCAAGTCATGG
CCGGACCTCACTCCCGGAGCGACGACCCCTGAGATCAAGCCGAGACCAACCCCATCCGCCGAAGCCGTCAAGACA
TCGGAGCTCCTCCTCACTCCCGACCTCGCAGCCCTGGCCCTCAGCGGCGCCCCCGTCAAAGCCCCCCTCTCGCCC
AAGCAGCGCCTCCTCCGGGAAGTGACCCCGGCGTCGACCCCGGGCCTGACATCGGGTCCGACTCGGAGTGGGGCC
GAAACACCCGTCACCTACCCTGTACCCACCGGTCCCGAACACCGCACCCATCTGATCCATACCTCGGGAACGACG
GGCGAAGCCAAGGCGGTACAGATCGCGGGCCGATCCGTCATCCACGTGGCGCATCACGTTCCGCTCGAGCCGCTG
CGTTCCTCCGACGTGGTGGCGCACGTCAACAATAGCAGCTTCGACGTCTCGCTCATCGACGTGTGGGCGCCGCTC
CTTCGGGGGGCGAGCATCGCCGTGCTTTCCAAGGCCGTGCTCTTGGATCCGCCGGCCATGGAGAGGGAGATTGAG
AGGTTGGGGGTTACGGTCATGGCCACCACCACGGCGTTGCTTAACCTCGTCGCCTTCACCCATCCCACTGCCTTT
TCGGGCTTGAGGATCTGCTTCATCGGCGGCGAGCAGGCCAACGTGGGTGCCATCAAGGTCGTGCTCGAAAAGGGG
CCGCCCGGGATGCTCGTGAATGCCTATGGTCCGACTGAGTGTTGCGTCTTCTGTCTCGCCCGTGTGGTGAGGCAC
GAGGATGTCGAGGCCGGGAGTGTGAGTATCGGGACGGCCATCGGTCGGAATGAGGCTCTCGTTGTCGATGATGAG
GGTCGGCTGAGTGAGGAGGGCGAGTTGTGGATCGCTGGACCGGGTCTGTCTCCCGGATACGCCAACCATCCGGAG
AAGACGGAGGCGGCCTTTCCGGTCTTGGCGGACGGTCGTCGCGTCTACCGGACCGGAGATATCGTCCGACGCCGT
CAAGACGGACAGATGGACTACATCGGCCGAAGAGATCACCAAGTCAAAGTGCGAGGATTCCGAATCGAGCTCGGA
GCCGTCGAAGCCGCCCTTCTGCAGACGGCTTTATTCTCCGAAGCCGTGGCGCTGAAGATGGACATCCCACGACTG
GGAGCCGGGTCCATCCTCGTGGCCTACGTCGTCCCCGTCCATGTTTCGGAACCGCCGGTCGTGTCGGAGGCGTTG
GCCAAGGTCAGGCATCTGCTTCCGGAGTACATGGTTCCTCAGCTGGAGATGGTGGAGAGGTTGCCTTTGAGTAGC
CATGCCAAGGTTGATCGAAACAAGTTGGCTGAGCTTTTCGCCAGTCGGTGGGCGACGACGATGACGACGACGACG
ACGACGGGGGAAGAGGAGGGAAAGGATAAGATTAACAAGGTGTTTGATGCCGCGTCTCGGCCCGGGGAGGTCCGG
GATGCCATGGCTCATCTTTGGGAGTCGATCCTGGCTGTTCCGTCGAGGGCTTTCGGTGATTCGGATGATTTCATC
AGCCTTGGTGGCTCGTCGCTTCAGGCTTCGCTACTCGTCAGCCAGATTCGACAGACGTTCGGACTCGAGATCCCT
CTCCTGACGCTATATCGAGACTTCAGTCTCGGAGCCGTCTCTTCCGTCGTCTCCGCCGGACTGGTCGGATCGGTA
CCGGCTCCTCCGGACGAGCGCGAGACGTGGATCGCAGACGGACTGATTGGCGACGCTCTGCCCATCCCAACAGGA
CAAGTCATCGACTGGCGAGCAGAAGGCGAAGGCCGGGTCTTCGTCACGGGAGCGACCGGATTCGTCGGCGCCTTC
CTCATGGCCGATTTGATGGTCGACGAAAAGGTCGAGCGAGTCTGCTGTCTCGTTCGTGCTGCGGATGCCGTCGAG
GGTCTCGGAAGGATTCGAGCTGGTATGGAAAAGTATGGGCTTTGGAAAGATGACTTTGTCGAGAGGTTGCTTGTC
GTGACGGGGCTTCTTGAGGATGAGAACTTGGGGTTGGGAGTCGATGGCTTTGAGGCTGTTGCTTCGTGGGCGAGC
GTCATCTTTCATCTCGGGGCTCGAGTCAACTATACGCAACCGTACGGTCTTCACCGGGCAGCCAATACCCTGGGG
ACGCTCAACGTCGTCCGCCTCTCGACGGCGGGACATCGACTCAAGCCTCTGCATTACGTGTCGAGCATCTCGTGC
TTCGGACCGACGGGGTTGATGACGGGTGCAAAACTAGTCCGCGAGGATGAGCCGCTCCTTCGTCATATCGATGCC
CTTCCTCTGGATCACGGCTATGCTCAGAGCCAGTGGGTTGCTGAGCGGCTCGTCGGACGACTCATAGAGCGTGGC
TTCCCCATTGCCGTCTACAGACCCGGTTTCGTGACGGGACATAGTCGGACGGGGGCCTGCAACCGGGATGATTTC
GTCAGTCGCTTGATCGAGGCATGCTGCGAGATGGGATGCTACCCTCTTCTTCCCAACCAGCGAAAGGAGTTCGTT
CCGGTGGATTACGTCTGCGCCGCTATCCTGCACATCGCGGCCTCGCCTACTTCCCCCGGAAAGGCCTTTCACATC
GTTCCGCCCTCGCGCGAGGCTTCCGTCGACATGGACGCCACCATGGATCTGGTGGGACGCGCTCGGAATACGCCG
TTGAGGGGCGTGCCCTACGGTGAATGGGTTGAGAGGCTGGCCGTGGTTGCGCCCCTGAGGTTGCTTCCTCTGCAG
CCTATGCTCGCGGAGAAGATTCGGGGGGGGAGGACGAGGTGGGAGTTGTATGAGAACATGCCCGTTTACGACACG
TCGAACACGGATGCGGCTTTGGCGGATTATCCGGGGGGGTTGGTGTTGCCTGAGTTGGATGAGGGGTTGATGAAG
AGGTATATTGATTTCATTGAGGGATCCAAGTAA
Transcript >Ophcf2|03985
ATGGCCTTGAACGCTGAGAATCTGTCTCACGACCAGATGTCCATGGCTGCTGATATCGGTCCCGTCATGCCGAGC
CTCGACCCCCTACTAGCCGAATCCCTCCAAGACCCGAACCCCCCATCGTCAGCCCCAGAAGAAACCATGGCGGGA
GAAGGAGGCTATGAAGACGTGGCTGTCTCGGGACTCGGCCTGGCAGAGCTCTTCCACAGGCAGACGGTCAAGAGA
GCGGCTTCGGTGGCCGTCGTCGACGGATGCCGCACGCTGACGTACCGCCAGCTCGATGCCCGTGCCGTCCGTCTG
GCCCGTGTCTTGAACCGGGACGGAGGTGCGGCTGGGTTGAGGGAGGAGGTCGTCGGTATCGTGGTGAGGCATGGC
GTCGCCGACGTGGTGGCTCAGATGGCAGTCTTGTATGCTGGCGGGAGCTGTGCGCCCATGGATCCTACGCTCGTC
GATCATCAGATCGAGGCGAGGTTGAAGAGGTTGGGTGCCAGGTTCGTGCTGGTCGACGGGGAGAATGGGAAGAGG
GCCTTTCCGTTTGATACGGTCTGCATCGACGACGAGGGTGACGATACGGACGAGGAGGAAGAAGTCAAGTCATGG
CCGGACCTCACTCCCGGAGCGACGACCCCTGAGATCAAGCCGAGACCAACCCCATCCGCCGAAGCCGTCAAGACA
TCGGAGCTCCTCCTCACTCCCGACCTCGCAGCCCTGGCCCTCAGCGGCGCCCCCGTCAAAGCCCCCCTCTCGCCC
AAGCAGCGCCTCCTCCGGGAAGTGACCCCGGCGTCGACCCCGGGCCTGACATCGGGTCCGACTCGGAGTGGGGCC
GAAACACCCGTCACCTACCCTGTACCCACCGGTCCCGAACACCGCACCCATCTGATCCATACCTCGGGAACGACG
GGCGAAGCCAAGGCGGTACAGATCGCGGGCCGATCCGTCATCCACGTGGCGCATCACGTTCCGCTCGAGCCGCTG
CGTTCCTCCGACGTGGTGGCGCACGTCAACAATAGCAGCTTCGACGTCTCGCTCATCGACGTGTGGGCGCCGCTC
CTTCGGGGGGCGAGCATCGCCGTGCTTTCCAAGGCCGTGCTCTTGGATCCGCCGGCCATGGAGAGGGAGATTGAG
AGGTTGGGGGTTACGGTCATGGCCACCACCACGGCGTTGCTTAACCTCGTCGCCTTCACCCATCCCACTGCCTTT
TCGGGCTTGAGGATCTGCTTCATCGGCGGCGAGCAGGCCAACGTGGGTGCCATCAAGGTCGTGCTCGAAAAGGGG
CCGCCCGGGATGCTCGTGAATGCCTATGGTCCGACTGAGTGTTGCGTCTTCTGTCTCGCCCGTGTGGTGAGGCAC
GAGGATGTCGAGGCCGGGAGTGTGAGTATCGGGACGGCCATCGGTCGGAATGAGGCTCTCGTTGTCGATGATGAG
GGTCGGCTGAGTGAGGAGGGCGAGTTGTGGATCGCTGGACCGGGTCTGTCTCCCGGATACGCCAACCATCCGGAG
AAGACGGAGGCGGCCTTTCCGGTCTTGGCGGACGGTCGTCGCGTCTACCGGACCGGAGATATCGTCCGACGCCGT
CAAGACGGACAGATGGACTACATCGGCCGAAGAGATCACCAAGTCAAAGTGCGAGGATTCCGAATCGAGCTCGGA
GCCGTCGAAGCCGCCCTTCTGCAGACGGCTTTATTCTCCGAAGCCGTGGCGCTGAAGATGGACATCCCACGACTG
GGAGCCGGGTCCATCCTCGTGGCCTACGTCGTCCCCGTCCATGTTTCGGAACCGCCGGTCGTGTCGGAGGCGTTG
GCCAAGGTCAGGCATCTGCTTCCGGAGTACATGGTTCCTCAGCTGGAGATGGTGGAGAGGTTGCCTTTGAGTAGC
CATGCCAAGGTTGATCGAAACAAGTTGGCTGAGCTTTTCGCCAGTCGGTGGGCGACGACGATGACGACGACGACG
ACGACGGGGGAAGAGGAGGGAAAGGATAAGATTAACAAGGTGTTTGATGCCGCGTCTCGGCCCGGGGAGGTCCGG
GATGCCATGGCTCATCTTTGGGAGTCGATCCTGGCTGTTCCGTCGAGGGCTTTCGGTGATTCGGATGATTTCATC
AGCCTTGGTGGCTCGTCGCTTCAGGCTTCGCTACTCGTCAGCCAGATTCGACAGACGTTCGGACTCGAGATCCCT
CTCCTGACGCTATATCGAGACTTCAGTCTCGGAGCCGTCTCTTCCGTCGTCTCCGCCGGACTGGTCGGATCGGTA
CCGGCTCCTCCGGACGAGCGCGAGACGTGGATCGCAGACGGACTGATTGGCGACGCTCTGCCCATCCCAACAGGA
CAAGTCATCGACTGGCGAGCAGAAGGCGAAGGCCGGGTCTTCGTCACGGGAGCGACCGGATTCGTCGGCGCCTTC
CTCATGGCCGATTTGATGGTCGACGAAAAGGTCGAGCGAGTCTGCTGTCTCGTTCGTGCTGCGGATGCCGTCGAG
GGTCTCGGAAGGATTCGAGCTGGTATGGAAAAGTATGGGCTTTGGAAAGATGACTTTGTCGAGAGGTTGCTTGTC
GTGACGGGGCTTCTTGAGGATGAGAACTTGGGGTTGGGAGTCGATGGCTTTGAGGCTGTTGCTTCGTGGGCGAGC
GTCATCTTTCATCTCGGGGCTCGAGTCAACTATACGCAACCGTACGGTCTTCACCGGGCAGCCAATACCCTGGGG
ACGCTCAACGTCGTCCGCCTCTCGACGGCGGGACATCGACTCAAGCCTCTGCATTACGTGTCGAGCATCTCGTGC
TTCGGACCGACGGGGTTGATGACGGGTGCAAAACTAGTCCGCGAGGATGAGCCGCTCCTTCGTCATATCGATGCC
CTTCCTCTGGATCACGGCTATGCTCAGAGCCAGTGGGTTGCTGAGCGGCTCGTCGGACGACTCATAGAGCGTGGC
TTCCCCATTGCCGTCTACAGACCCGGTTTCGTGACGGGACATAGTCGGACGGGGGCCTGCAACCGGGATGATTTC
GTCAGTCGCTTGATCGAGGCATGCTGCGAGATGGGATGCTACCCTCTTCTTCCCAACCAGCGAAAGGAGTTCGTT
CCGGTGGATTACGTCTGCGCCGCTATCCTGCACATCGCGGCCTCGCCTACTTCCCCCGGAAAGGCCTTTCACATC
GTTCCGCCCTCGCGCGAGGCTTCCGTCGACATGGACGCCACCATGGATCTGGTGGGACGCGCTCGGAATACGCCG
TTGAGGGGCGTGCCCTACGGTGAATGGGTTGAGAGGCTGGCCGTGGTTGCGCCCCTGAGGTTGCTTCCTCTGCAG
CCTATGCTCGCGGAGAAGATTCGGGGGGGGAGGACGAGGTGGGAGTTGTATGAGAACATGCCCGTTTACGACACG
TCGAACACGGATGCGGCTTTGGCGGATTATCCGGGGGGGTTGGTGTTGCCTGAGTTGGATGAGGGGTTGATGAAG
AGGTATATTGATTTCATTGAGGGATCCAAGTAA
Gene >Ophcf2|03985
ATGGCCTTGAACGCTGAGAATCTGTCTCACGACCAGATGTCCATGGCTGCTGATATCGGTCCCGTCATGCCGAGC
CTCGACCCCCTACTAGCCGAATCCCTCCAAGACCCGAACCCCCCATCGTCAGCCCCAGAAGAAACCATGGCGGGA
GAAGGAGGCTATGAAGACGTGGCTGTCTCGGGACTCGGCCTGGCAGAGCTCTTCCACAGGCAGACGGTCAAGAGA
GCGGCTTCGGTGGCCGTCGTCGACGGATGCCGCACGCTGACGTACCGCCAGCTCGATGCCCGTGCCGTCCGTCTG
GCCCGTGTCTTGAACCGGGACGGAGGTGCGGCTGGGTTGAGGGAGGAGGTCGTCGGTATCGTGGTGAGGCATGGC
GTCGCCGACGTGGTGGCTCAGATGGCAGTCTTGTATGCTGGCGGGAGCTGTGCGCCCATGGATCCTACGCTCGTC
GATCATCAGATCGAGGCGAGGTTGAAGAGGTTGGGTGCCAGGTTCGTGCTGGTCGACGGGGAGAATGGGAAGAGG
GCCTTTCCGTTTGATACGGTCTGCATCGACGACGAGGGTGACGATACGGACGAGGAGGAAGAAGTCAAGTCATGG
CCGGACCTCACTCCCGGAGCGACGACCCCTGAGATCAAGCCGAGACCAACCCCATCCGCCGAAGCCGTCAAGACA
TCGGAGCTCCTCCTCACTCCCGACCTCGCAGCCCTGGCCCTCAGCGGCGCCCCCGTCAAAGCCCCCCTCTCGCCC
AAGCAGCGCCTCCTCCGGGAAGTGACCCCGGCGTCGACCCCGGGCCTGACATCGGGTCCGACTCGGAGTGGGGCC
GAAACACCCGTCACCTACCCTGTACCCACCGGTCCCGAACACCGCACCCATCTGATCCATACCTCGGGAACGACG
GGCGAAGCCAAGGCGGTACAGATCGCGGGCCGATCCGTCATCCACGTGGCGCATCACGTTCCGCTCGAGCCGCTG
CGTTCCTCCGACGTGGTGGCGCACGTCAACAATAGCAGCTTCGACGTCTCGCTCATCGACGTGTGGGCGCCGCTC
CTTCGGGGGGCGAGCATCGCCGTGCTTTCCAAGGCCGTGCTCTTGGATCCGCCGGCCATGGAGAGGGAGATTGAG
AGGTTGGGGGTTACGGTCATGGCCACCACCACGGCGTTGCTTAACCTCGTCGCCTTCACCCATCCCACTGCCTTT
TCGGGCTTGAGGATCTGCTTCATCGGCGGCGAGCAGGCCAACGTGGGTGCCATCAAGGTCGTGCTCGAAAAGGGG
CCGCCCGGGATGCTCGTGAATGCCTATGGTCCGACTGAGTGTTGCGTCTTCTGTCTCGCCCGTGTGGTGAGGCAC
GAGGATGTCGAGGCCGGGAGTGTGAGTATCGGGACGGCCATCGGTCGGAATGAGGCTCTCGTTGTCGATGATGAG
GGTCGGCTGAGTGAGGAGGGCGAGTTGTGGATCGCTGGACCGGGTCTGTCTCCCGGATACGCCAACCATCCGGAG
AAGACGGAGGCGGCCTTTCCGGTCTTGGCGGACGGTCGTCGCGTCTACCGGACCGGAGATATCGTCCGACGCCGT
CAAGACGGACAGATGGACTACATCGGCCGAAGAGATCACCAAGTCAAAGTGCGAGGATTCCGAATCGAGCTCGGA
GCCGTCGAAGCCGCCCTTCTGCAGACGGCTTTATTCTCCGAAGCCGTGGCGCTGAAGATGGACATCCCACGACTG
GGAGCCGGGTCCATCCTCGTGGCCTACGTCGTCCCCGTCCATGTTTCGGAACCGCCGGTCGTGTCGGAGGCGTTG
GCCAAGGTCAGGCATCTGCTTCCGGAGTACATGGTTCCTCAGCTGGAGATGGTGGAGAGGTTGCCTTTGAGTAGC
CATGCCAAGGTTGATCGAAACAAGTTGGCTGAGCTTTTCGCCAGTCGGTGGGCGACGACGATGACGACGACGACG
ACGACGGGGGAAGAGGAGGGAAAGGATAAGATTAACAAGGTGTTTGATGCCGCGTCTCGGCCCGGGGAGGTCCGG
GATGCCATGGCTCATCTTTGGGAGTCGATCCTGGCTGTTCCGTCGAGGGCTTTCGGTGATTCGGATGATTTCATC
AGCCTTGGTGGCTCGTCGCTTCAGGCTTCGCTACTCGTCAGCCAGATTCGACAGACGTTCGGACTCGAGATCCCT
CTCCTGACGCTATATCGAGACTTCAGTCTCGGAGCCGTCTCTTCCGTCGTCTCCGCCGGACTGGTCGGATCGGTA
CCGGCTCCTCCGGACGAGCGCGAGACGTGGATCGCAGACGGACTGATTGGCGACGCTCTGCCCATCCCAACAGGA
CAAGTCATCGACTGGCGAGCAGAAGGCGAAGGCCGGGTCTTCGTCACGGGAGCGACCGGATTCGTCGGCGCCTTC
CTCATGGCCGATTTGATGGTCGACGAAAAGGTCGAGCGAGTCTGCTGTCTCGTTCGTGCTGCGGATGCCGTCGAG
GGTCTCGGAAGGATTCGAGCTGGTATGGAAAAGTATGGGCTTTGGAAAGATGACTTTGTCGAGAGGTTGCTTGTC
GTGACGGGGCTTCTTGAGGATGAGAACTTGGGGTTGGGAGTCGATGGCTTTGAGGCTGTTGCTTCGTGGGCGAGC
GTCATCTTTCATCTCGGGGCTCGAGTCAACTATACGCAACCGTACGGTCTTCACCGGGCAGCCAATACCCTGGGG
ACGCTCAACGTCGTCCGCCTCTCGACGGCGGGACATCGACTCAAGCCTCTGCATTACGTGTCGAGCATCTCGTGC
TTCGGACCGACGGGGTTGATGACGGGTGCAAAACTAGTCCGCGAGGATGAGCCGCTCCTTCGTCATATCGATGCC
CTTCCTCTGGATCACGGCTATGCTCAGAGCCAGTGGGTTGCTGAGCGGCTCGTCGGACGACTCATAGAGCGTGGC
TTCCCCATTGCCGTCTACAGACCCGGTTTCGTGACGGGACATAGTCGGACGGGGGCCTGCAACCGGGATGATTTC
GTCAGTCGCTTGATCGAGGCATGCTGCGAGATGGGATGCTACCCTCTTCTTCCCAACCAGCGAAAGGAGTTCGTT
CCGGTGGATTACGTCTGCGCCGCTATCCTGCACATCGCGGCCTCGCCTACTTCCCCCGGAAAGGCCTTTCACATC
GTTCCGCCCTCGCGCGAGGCTTCCGTCGACATGGACGCCACCATGGATCTGGTGGGACGCGCTCGGAATACGCCG
TTGAGGGGCGTGCCCTACGGTGAATGGGTTGAGAGGCTGGCCGTGGTTGCGCCCCTGAGGTTGCTTCCTCTGCAG
CCTATGCTCGCGGAGAAGATTCGGGGGGGGAGGACGAGGTGGGAGTTGTATGAGAACATGCCCGTTTACGACACG
TCGAACACGGATGCGGCTTTGGCGGATTATCCGGGGGGGTTGGTGTTGCCTGAGTTGGATGAGGGGTTGATGAAG
AGGTATATTGATTTCATTGAGGGATCCAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail