Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03985
Gene name
Locationscaffold_04:553877..557360
Strand+
Gene length (bp)3483
Transcript length (bp)3483
Coding sequence length (bp)3483
Protein length (aa) 1161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 5.5E-72 69 543
PF07993 NAD_binding_4 Male sterility protein 1.9E-54 790 1034
PF00550 PP-binding Phosphopantetheine attachment site 7.8E-09 680 734
PF01370 Epimerase NAD dependent epimerase/dehydratase family 5.5E-06 788 1043

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03985
MALNAENLSHDQMSMAADIGPVMPSLDPLLAESLQDPNPPSSAPEETMAGEGGYEDVAVSGLGLAELFHRQTVKR
AASVAVVDGCRTLTYRQLDARAVRLARVLNRDGGAAGLREEVVGIVVRHGVADVVAQMAVLYAGGSCAPMDPTLV
DHQIEARLKRLGARFVLVDGENGKRAFPFDTVCIDDEGDDTDEEEEVKSWPDLTPGATTPEIKPRPTPSAEAVKT
SELLLTPDLAALALSGAPVKAPLSPKQRLLREVTPASTPGLTSGPTRSGAETPVTYPVPTGPEHRTHLIHTSGTT
GEAKAVQIAGRSVIHVAHHVPLEPLRSSDVVAHVNNSSFDVSLIDVWAPLLRGASIAVLSKAVLLDPPAMEREIE
RLGVTVMATTTALLNLVAFTHPTAFSGLRICFIGGEQANVGAIKVVLEKGPPGMLVNAYGPTECCVFCLARVVRH
EDVEAGSVSIGTAIGRNEALVVDDEGRLSEEGELWIAGPGLSPGYANHPEKTEAAFPVLADGRRVYRTGDIVRRR
QDGQMDYIGRRDHQVKVRGFRIELGAVEAALLQTALFSEAVALKMDIPRLGAGSILVAYVVPVHVSEPPVVSEAL
AKVRHLLPEYMVPQLEMVERLPLSSHAKVDRNKLAELFASRWATTMTTTTTTGEEEGKDKINKVFDAASRPGEVR
DAMAHLWESILAVPSRAFGDSDDFISLGGSSLQASLLVSQIRQTFGLEIPLLTLYRDFSLGAVSSVVSAGLVGSV
PAPPDERETWIADGLIGDALPIPTGQVIDWRAEGEGRVFVTGATGFVGAFLMADLMVDEKVERVCCLVRAADAVE
GLGRIRAGMEKYGLWKDDFVERLLVVTGLLEDENLGLGVDGFEAVASWASVIFHLGARVNYTQPYGLHRAANTLG
TLNVVRLSTAGHRLKPLHYVSSISCFGPTGLMTGAKLVREDEPLLRHIDALPLDHGYAQSQWVAERLVGRLIERG
FPIAVYRPGFVTGHSRTGACNRDDFVSRLIEACCEMGCYPLLPNQRKEFVPVDYVCAAILHIAASPTSPGKAFHI
VPPSREASVDMDATMDLVGRARNTPLRGVPYGEWVERLAVVAPLRLLPLQPMLAEKIRGGRTRWELYENMPVYDT
SNTDAALADYPGGLVLPELDEGLMKRYIDFIEGSK*
Coding >Ophcf2|03985
ATGGCCTTGAACGCTGAGAATCTGTCTCACGACCAGATGTCCATGGCTGCTGATATCGGTCCCGTCATGCCGAGC
CTCGACCCCCTACTAGCCGAATCCCTCCAAGACCCGAACCCCCCATCGTCAGCCCCAGAAGAAACCATGGCGGGA
GAAGGAGGCTATGAAGACGTGGCTGTCTCGGGACTCGGCCTGGCAGAGCTCTTCCACAGGCAGACGGTCAAGAGA
GCGGCTTCGGTGGCCGTCGTCGACGGATGCCGCACGCTGACGTACCGCCAGCTCGATGCCCGTGCCGTCCGTCTG
GCCCGTGTCTTGAACCGGGACGGAGGTGCGGCTGGGTTGAGGGAGGAGGTCGTCGGTATCGTGGTGAGGCATGGC
GTCGCCGACGTGGTGGCTCAGATGGCAGTCTTGTATGCTGGCGGGAGCTGTGCGCCCATGGATCCTACGCTCGTC
GATCATCAGATCGAGGCGAGGTTGAAGAGGTTGGGTGCCAGGTTCGTGCTGGTCGACGGGGAGAATGGGAAGAGG
GCCTTTCCGTTTGATACGGTCTGCATCGACGACGAGGGTGACGATACGGACGAGGAGGAAGAAGTCAAGTCATGG
CCGGACCTCACTCCCGGAGCGACGACCCCTGAGATCAAGCCGAGACCAACCCCATCCGCCGAAGCCGTCAAGACA
TCGGAGCTCCTCCTCACTCCCGACCTCGCAGCCCTGGCCCTCAGCGGCGCCCCCGTCAAAGCCCCCCTCTCGCCC
AAGCAGCGCCTCCTCCGGGAAGTGACCCCGGCGTCGACCCCGGGCCTGACATCGGGTCCGACTCGGAGTGGGGCC
GAAACACCCGTCACCTACCCTGTACCCACCGGTCCCGAACACCGCACCCATCTGATCCATACCTCGGGAACGACG
GGCGAAGCCAAGGCGGTACAGATCGCGGGCCGATCCGTCATCCACGTGGCGCATCACGTTCCGCTCGAGCCGCTG
CGTTCCTCCGACGTGGTGGCGCACGTCAACAATAGCAGCTTCGACGTCTCGCTCATCGACGTGTGGGCGCCGCTC
CTTCGGGGGGCGAGCATCGCCGTGCTTTCCAAGGCCGTGCTCTTGGATCCGCCGGCCATGGAGAGGGAGATTGAG
AGGTTGGGGGTTACGGTCATGGCCACCACCACGGCGTTGCTTAACCTCGTCGCCTTCACCCATCCCACTGCCTTT
TCGGGCTTGAGGATCTGCTTCATCGGCGGCGAGCAGGCCAACGTGGGTGCCATCAAGGTCGTGCTCGAAAAGGGG
CCGCCCGGGATGCTCGTGAATGCCTATGGTCCGACTGAGTGTTGCGTCTTCTGTCTCGCCCGTGTGGTGAGGCAC
GAGGATGTCGAGGCCGGGAGTGTGAGTATCGGGACGGCCATCGGTCGGAATGAGGCTCTCGTTGTCGATGATGAG
GGTCGGCTGAGTGAGGAGGGCGAGTTGTGGATCGCTGGACCGGGTCTGTCTCCCGGATACGCCAACCATCCGGAG
AAGACGGAGGCGGCCTTTCCGGTCTTGGCGGACGGTCGTCGCGTCTACCGGACCGGAGATATCGTCCGACGCCGT
CAAGACGGACAGATGGACTACATCGGCCGAAGAGATCACCAAGTCAAAGTGCGAGGATTCCGAATCGAGCTCGGA
GCCGTCGAAGCCGCCCTTCTGCAGACGGCTTTATTCTCCGAAGCCGTGGCGCTGAAGATGGACATCCCACGACTG
GGAGCCGGGTCCATCCTCGTGGCCTACGTCGTCCCCGTCCATGTTTCGGAACCGCCGGTCGTGTCGGAGGCGTTG
GCCAAGGTCAGGCATCTGCTTCCGGAGTACATGGTTCCTCAGCTGGAGATGGTGGAGAGGTTGCCTTTGAGTAGC
CATGCCAAGGTTGATCGAAACAAGTTGGCTGAGCTTTTCGCCAGTCGGTGGGCGACGACGATGACGACGACGACG
ACGACGGGGGAAGAGGAGGGAAAGGATAAGATTAACAAGGTGTTTGATGCCGCGTCTCGGCCCGGGGAGGTCCGG
GATGCCATGGCTCATCTTTGGGAGTCGATCCTGGCTGTTCCGTCGAGGGCTTTCGGTGATTCGGATGATTTCATC
AGCCTTGGTGGCTCGTCGCTTCAGGCTTCGCTACTCGTCAGCCAGATTCGACAGACGTTCGGACTCGAGATCCCT
CTCCTGACGCTATATCGAGACTTCAGTCTCGGAGCCGTCTCTTCCGTCGTCTCCGCCGGACTGGTCGGATCGGTA
CCGGCTCCTCCGGACGAGCGCGAGACGTGGATCGCAGACGGACTGATTGGCGACGCTCTGCCCATCCCAACAGGA
CAAGTCATCGACTGGCGAGCAGAAGGCGAAGGCCGGGTCTTCGTCACGGGAGCGACCGGATTCGTCGGCGCCTTC
CTCATGGCCGATTTGATGGTCGACGAAAAGGTCGAGCGAGTCTGCTGTCTCGTTCGTGCTGCGGATGCCGTCGAG
GGTCTCGGAAGGATTCGAGCTGGTATGGAAAAGTATGGGCTTTGGAAAGATGACTTTGTCGAGAGGTTGCTTGTC
GTGACGGGGCTTCTTGAGGATGAGAACTTGGGGTTGGGAGTCGATGGCTTTGAGGCTGTTGCTTCGTGGGCGAGC
GTCATCTTTCATCTCGGGGCTCGAGTCAACTATACGCAACCGTACGGTCTTCACCGGGCAGCCAATACCCTGGGG
ACGCTCAACGTCGTCCGCCTCTCGACGGCGGGACATCGACTCAAGCCTCTGCATTACGTGTCGAGCATCTCGTGC
TTCGGACCGACGGGGTTGATGACGGGTGCAAAACTAGTCCGCGAGGATGAGCCGCTCCTTCGTCATATCGATGCC
CTTCCTCTGGATCACGGCTATGCTCAGAGCCAGTGGGTTGCTGAGCGGCTCGTCGGACGACTCATAGAGCGTGGC
TTCCCCATTGCCGTCTACAGACCCGGTTTCGTGACGGGACATAGTCGGACGGGGGCCTGCAACCGGGATGATTTC
GTCAGTCGCTTGATCGAGGCATGCTGCGAGATGGGATGCTACCCTCTTCTTCCCAACCAGCGAAAGGAGTTCGTT
CCGGTGGATTACGTCTGCGCCGCTATCCTGCACATCGCGGCCTCGCCTACTTCCCCCGGAAAGGCCTTTCACATC
GTTCCGCCCTCGCGCGAGGCTTCCGTCGACATGGACGCCACCATGGATCTGGTGGGACGCGCTCGGAATACGCCG
TTGAGGGGCGTGCCCTACGGTGAATGGGTTGAGAGGCTGGCCGTGGTTGCGCCCCTGAGGTTGCTTCCTCTGCAG
CCTATGCTCGCGGAGAAGATTCGGGGGGGGAGGACGAGGTGGGAGTTGTATGAGAACATGCCCGTTTACGACACG
TCGAACACGGATGCGGCTTTGGCGGATTATCCGGGGGGGTTGGTGTTGCCTGAGTTGGATGAGGGGTTGATGAAG
AGGTATATTGATTTCATTGAGGGATCCAAGTAA
Transcript >Ophcf2|03985
ATGGCCTTGAACGCTGAGAATCTGTCTCACGACCAGATGTCCATGGCTGCTGATATCGGTCCCGTCATGCCGAGC
CTCGACCCCCTACTAGCCGAATCCCTCCAAGACCCGAACCCCCCATCGTCAGCCCCAGAAGAAACCATGGCGGGA
GAAGGAGGCTATGAAGACGTGGCTGTCTCGGGACTCGGCCTGGCAGAGCTCTTCCACAGGCAGACGGTCAAGAGA
GCGGCTTCGGTGGCCGTCGTCGACGGATGCCGCACGCTGACGTACCGCCAGCTCGATGCCCGTGCCGTCCGTCTG
GCCCGTGTCTTGAACCGGGACGGAGGTGCGGCTGGGTTGAGGGAGGAGGTCGTCGGTATCGTGGTGAGGCATGGC
GTCGCCGACGTGGTGGCTCAGATGGCAGTCTTGTATGCTGGCGGGAGCTGTGCGCCCATGGATCCTACGCTCGTC
GATCATCAGATCGAGGCGAGGTTGAAGAGGTTGGGTGCCAGGTTCGTGCTGGTCGACGGGGAGAATGGGAAGAGG
GCCTTTCCGTTTGATACGGTCTGCATCGACGACGAGGGTGACGATACGGACGAGGAGGAAGAAGTCAAGTCATGG
CCGGACCTCACTCCCGGAGCGACGACCCCTGAGATCAAGCCGAGACCAACCCCATCCGCCGAAGCCGTCAAGACA
TCGGAGCTCCTCCTCACTCCCGACCTCGCAGCCCTGGCCCTCAGCGGCGCCCCCGTCAAAGCCCCCCTCTCGCCC
AAGCAGCGCCTCCTCCGGGAAGTGACCCCGGCGTCGACCCCGGGCCTGACATCGGGTCCGACTCGGAGTGGGGCC
GAAACACCCGTCACCTACCCTGTACCCACCGGTCCCGAACACCGCACCCATCTGATCCATACCTCGGGAACGACG
GGCGAAGCCAAGGCGGTACAGATCGCGGGCCGATCCGTCATCCACGTGGCGCATCACGTTCCGCTCGAGCCGCTG
CGTTCCTCCGACGTGGTGGCGCACGTCAACAATAGCAGCTTCGACGTCTCGCTCATCGACGTGTGGGCGCCGCTC
CTTCGGGGGGCGAGCATCGCCGTGCTTTCCAAGGCCGTGCTCTTGGATCCGCCGGCCATGGAGAGGGAGATTGAG
AGGTTGGGGGTTACGGTCATGGCCACCACCACGGCGTTGCTTAACCTCGTCGCCTTCACCCATCCCACTGCCTTT
TCGGGCTTGAGGATCTGCTTCATCGGCGGCGAGCAGGCCAACGTGGGTGCCATCAAGGTCGTGCTCGAAAAGGGG
CCGCCCGGGATGCTCGTGAATGCCTATGGTCCGACTGAGTGTTGCGTCTTCTGTCTCGCCCGTGTGGTGAGGCAC
GAGGATGTCGAGGCCGGGAGTGTGAGTATCGGGACGGCCATCGGTCGGAATGAGGCTCTCGTTGTCGATGATGAG
GGTCGGCTGAGTGAGGAGGGCGAGTTGTGGATCGCTGGACCGGGTCTGTCTCCCGGATACGCCAACCATCCGGAG
AAGACGGAGGCGGCCTTTCCGGTCTTGGCGGACGGTCGTCGCGTCTACCGGACCGGAGATATCGTCCGACGCCGT
CAAGACGGACAGATGGACTACATCGGCCGAAGAGATCACCAAGTCAAAGTGCGAGGATTCCGAATCGAGCTCGGA
GCCGTCGAAGCCGCCCTTCTGCAGACGGCTTTATTCTCCGAAGCCGTGGCGCTGAAGATGGACATCCCACGACTG
GGAGCCGGGTCCATCCTCGTGGCCTACGTCGTCCCCGTCCATGTTTCGGAACCGCCGGTCGTGTCGGAGGCGTTG
GCCAAGGTCAGGCATCTGCTTCCGGAGTACATGGTTCCTCAGCTGGAGATGGTGGAGAGGTTGCCTTTGAGTAGC
CATGCCAAGGTTGATCGAAACAAGTTGGCTGAGCTTTTCGCCAGTCGGTGGGCGACGACGATGACGACGACGACG
ACGACGGGGGAAGAGGAGGGAAAGGATAAGATTAACAAGGTGTTTGATGCCGCGTCTCGGCCCGGGGAGGTCCGG
GATGCCATGGCTCATCTTTGGGAGTCGATCCTGGCTGTTCCGTCGAGGGCTTTCGGTGATTCGGATGATTTCATC
AGCCTTGGTGGCTCGTCGCTTCAGGCTTCGCTACTCGTCAGCCAGATTCGACAGACGTTCGGACTCGAGATCCCT
CTCCTGACGCTATATCGAGACTTCAGTCTCGGAGCCGTCTCTTCCGTCGTCTCCGCCGGACTGGTCGGATCGGTA
CCGGCTCCTCCGGACGAGCGCGAGACGTGGATCGCAGACGGACTGATTGGCGACGCTCTGCCCATCCCAACAGGA
CAAGTCATCGACTGGCGAGCAGAAGGCGAAGGCCGGGTCTTCGTCACGGGAGCGACCGGATTCGTCGGCGCCTTC
CTCATGGCCGATTTGATGGTCGACGAAAAGGTCGAGCGAGTCTGCTGTCTCGTTCGTGCTGCGGATGCCGTCGAG
GGTCTCGGAAGGATTCGAGCTGGTATGGAAAAGTATGGGCTTTGGAAAGATGACTTTGTCGAGAGGTTGCTTGTC
GTGACGGGGCTTCTTGAGGATGAGAACTTGGGGTTGGGAGTCGATGGCTTTGAGGCTGTTGCTTCGTGGGCGAGC
GTCATCTTTCATCTCGGGGCTCGAGTCAACTATACGCAACCGTACGGTCTTCACCGGGCAGCCAATACCCTGGGG
ACGCTCAACGTCGTCCGCCTCTCGACGGCGGGACATCGACTCAAGCCTCTGCATTACGTGTCGAGCATCTCGTGC
TTCGGACCGACGGGGTTGATGACGGGTGCAAAACTAGTCCGCGAGGATGAGCCGCTCCTTCGTCATATCGATGCC
CTTCCTCTGGATCACGGCTATGCTCAGAGCCAGTGGGTTGCTGAGCGGCTCGTCGGACGACTCATAGAGCGTGGC
TTCCCCATTGCCGTCTACAGACCCGGTTTCGTGACGGGACATAGTCGGACGGGGGCCTGCAACCGGGATGATTTC
GTCAGTCGCTTGATCGAGGCATGCTGCGAGATGGGATGCTACCCTCTTCTTCCCAACCAGCGAAAGGAGTTCGTT
CCGGTGGATTACGTCTGCGCCGCTATCCTGCACATCGCGGCCTCGCCTACTTCCCCCGGAAAGGCCTTTCACATC
GTTCCGCCCTCGCGCGAGGCTTCCGTCGACATGGACGCCACCATGGATCTGGTGGGACGCGCTCGGAATACGCCG
TTGAGGGGCGTGCCCTACGGTGAATGGGTTGAGAGGCTGGCCGTGGTTGCGCCCCTGAGGTTGCTTCCTCTGCAG
CCTATGCTCGCGGAGAAGATTCGGGGGGGGAGGACGAGGTGGGAGTTGTATGAGAACATGCCCGTTTACGACACG
TCGAACACGGATGCGGCTTTGGCGGATTATCCGGGGGGGTTGGTGTTGCCTGAGTTGGATGAGGGGTTGATGAAG
AGGTATATTGATTTCATTGAGGGATCCAAGTAA
Gene >Ophcf2|03985
ATGGCCTTGAACGCTGAGAATCTGTCTCACGACCAGATGTCCATGGCTGCTGATATCGGTCCCGTCATGCCGAGC
CTCGACCCCCTACTAGCCGAATCCCTCCAAGACCCGAACCCCCCATCGTCAGCCCCAGAAGAAACCATGGCGGGA
GAAGGAGGCTATGAAGACGTGGCTGTCTCGGGACTCGGCCTGGCAGAGCTCTTCCACAGGCAGACGGTCAAGAGA
GCGGCTTCGGTGGCCGTCGTCGACGGATGCCGCACGCTGACGTACCGCCAGCTCGATGCCCGTGCCGTCCGTCTG
GCCCGTGTCTTGAACCGGGACGGAGGTGCGGCTGGGTTGAGGGAGGAGGTCGTCGGTATCGTGGTGAGGCATGGC
GTCGCCGACGTGGTGGCTCAGATGGCAGTCTTGTATGCTGGCGGGAGCTGTGCGCCCATGGATCCTACGCTCGTC
GATCATCAGATCGAGGCGAGGTTGAAGAGGTTGGGTGCCAGGTTCGTGCTGGTCGACGGGGAGAATGGGAAGAGG
GCCTTTCCGTTTGATACGGTCTGCATCGACGACGAGGGTGACGATACGGACGAGGAGGAAGAAGTCAAGTCATGG
CCGGACCTCACTCCCGGAGCGACGACCCCTGAGATCAAGCCGAGACCAACCCCATCCGCCGAAGCCGTCAAGACA
TCGGAGCTCCTCCTCACTCCCGACCTCGCAGCCCTGGCCCTCAGCGGCGCCCCCGTCAAAGCCCCCCTCTCGCCC
AAGCAGCGCCTCCTCCGGGAAGTGACCCCGGCGTCGACCCCGGGCCTGACATCGGGTCCGACTCGGAGTGGGGCC
GAAACACCCGTCACCTACCCTGTACCCACCGGTCCCGAACACCGCACCCATCTGATCCATACCTCGGGAACGACG
GGCGAAGCCAAGGCGGTACAGATCGCGGGCCGATCCGTCATCCACGTGGCGCATCACGTTCCGCTCGAGCCGCTG
CGTTCCTCCGACGTGGTGGCGCACGTCAACAATAGCAGCTTCGACGTCTCGCTCATCGACGTGTGGGCGCCGCTC
CTTCGGGGGGCGAGCATCGCCGTGCTTTCCAAGGCCGTGCTCTTGGATCCGCCGGCCATGGAGAGGGAGATTGAG
AGGTTGGGGGTTACGGTCATGGCCACCACCACGGCGTTGCTTAACCTCGTCGCCTTCACCCATCCCACTGCCTTT
TCGGGCTTGAGGATCTGCTTCATCGGCGGCGAGCAGGCCAACGTGGGTGCCATCAAGGTCGTGCTCGAAAAGGGG
CCGCCCGGGATGCTCGTGAATGCCTATGGTCCGACTGAGTGTTGCGTCTTCTGTCTCGCCCGTGTGGTGAGGCAC
GAGGATGTCGAGGCCGGGAGTGTGAGTATCGGGACGGCCATCGGTCGGAATGAGGCTCTCGTTGTCGATGATGAG
GGTCGGCTGAGTGAGGAGGGCGAGTTGTGGATCGCTGGACCGGGTCTGTCTCCCGGATACGCCAACCATCCGGAG
AAGACGGAGGCGGCCTTTCCGGTCTTGGCGGACGGTCGTCGCGTCTACCGGACCGGAGATATCGTCCGACGCCGT
CAAGACGGACAGATGGACTACATCGGCCGAAGAGATCACCAAGTCAAAGTGCGAGGATTCCGAATCGAGCTCGGA
GCCGTCGAAGCCGCCCTTCTGCAGACGGCTTTATTCTCCGAAGCCGTGGCGCTGAAGATGGACATCCCACGACTG
GGAGCCGGGTCCATCCTCGTGGCCTACGTCGTCCCCGTCCATGTTTCGGAACCGCCGGTCGTGTCGGAGGCGTTG
GCCAAGGTCAGGCATCTGCTTCCGGAGTACATGGTTCCTCAGCTGGAGATGGTGGAGAGGTTGCCTTTGAGTAGC
CATGCCAAGGTTGATCGAAACAAGTTGGCTGAGCTTTTCGCCAGTCGGTGGGCGACGACGATGACGACGACGACG
ACGACGGGGGAAGAGGAGGGAAAGGATAAGATTAACAAGGTGTTTGATGCCGCGTCTCGGCCCGGGGAGGTCCGG
GATGCCATGGCTCATCTTTGGGAGTCGATCCTGGCTGTTCCGTCGAGGGCTTTCGGTGATTCGGATGATTTCATC
AGCCTTGGTGGCTCGTCGCTTCAGGCTTCGCTACTCGTCAGCCAGATTCGACAGACGTTCGGACTCGAGATCCCT
CTCCTGACGCTATATCGAGACTTCAGTCTCGGAGCCGTCTCTTCCGTCGTCTCCGCCGGACTGGTCGGATCGGTA
CCGGCTCCTCCGGACGAGCGCGAGACGTGGATCGCAGACGGACTGATTGGCGACGCTCTGCCCATCCCAACAGGA
CAAGTCATCGACTGGCGAGCAGAAGGCGAAGGCCGGGTCTTCGTCACGGGAGCGACCGGATTCGTCGGCGCCTTC
CTCATGGCCGATTTGATGGTCGACGAAAAGGTCGAGCGAGTCTGCTGTCTCGTTCGTGCTGCGGATGCCGTCGAG
GGTCTCGGAAGGATTCGAGCTGGTATGGAAAAGTATGGGCTTTGGAAAGATGACTTTGTCGAGAGGTTGCTTGTC
GTGACGGGGCTTCTTGAGGATGAGAACTTGGGGTTGGGAGTCGATGGCTTTGAGGCTGTTGCTTCGTGGGCGAGC
GTCATCTTTCATCTCGGGGCTCGAGTCAACTATACGCAACCGTACGGTCTTCACCGGGCAGCCAATACCCTGGGG
ACGCTCAACGTCGTCCGCCTCTCGACGGCGGGACATCGACTCAAGCCTCTGCATTACGTGTCGAGCATCTCGTGC
TTCGGACCGACGGGGTTGATGACGGGTGCAAAACTAGTCCGCGAGGATGAGCCGCTCCTTCGTCATATCGATGCC
CTTCCTCTGGATCACGGCTATGCTCAGAGCCAGTGGGTTGCTGAGCGGCTCGTCGGACGACTCATAGAGCGTGGC
TTCCCCATTGCCGTCTACAGACCCGGTTTCGTGACGGGACATAGTCGGACGGGGGCCTGCAACCGGGATGATTTC
GTCAGTCGCTTGATCGAGGCATGCTGCGAGATGGGATGCTACCCTCTTCTTCCCAACCAGCGAAAGGAGTTCGTT
CCGGTGGATTACGTCTGCGCCGCTATCCTGCACATCGCGGCCTCGCCTACTTCCCCCGGAAAGGCCTTTCACATC
GTTCCGCCCTCGCGCGAGGCTTCCGTCGACATGGACGCCACCATGGATCTGGTGGGACGCGCTCGGAATACGCCG
TTGAGGGGCGTGCCCTACGGTGAATGGGTTGAGAGGCTGGCCGTGGTTGCGCCCCTGAGGTTGCTTCCTCTGCAG
CCTATGCTCGCGGAGAAGATTCGGGGGGGGAGGACGAGGTGGGAGTTGTATGAGAACATGCCCGTTTACGACACG
TCGAACACGGATGCGGCTTTGGCGGATTATCCGGGGGGGTTGGTGTTGCCTGAGTTGGATGAGGGGTTGATGAAG
AGGTATATTGATTTCATTGAGGGATCCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail