Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03976
Gene name
Locationscaffold_04:532417..533323
Strand-
Gene length (bp)906
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 4.3E-07 40 88
PF13499 EF-hand_7 EF-hand domain pair 1.3E-15 99 171
PF00036 EF-hand_1 EF hand 1.2E-06 66 90
PF00036 EF-hand_1 EF hand 2.4E-08 101 127
PF00036 EF-hand_1 EF hand 5.8E-06 149 172
PF13405 EF-hand_6 EF-hand domain 2.2E-06 66 90
PF13202 EF-hand_5 EF hand 2.1E-04 66 85
PF13202 EF-hand_5 EF hand 2.9E-05 104 124
PF13202 EF-hand_5 EF hand 1.2E-04 150 171
PF13833 EF-hand_8 EF-hand domain pair 9.0E-05 40 86
PF13833 EF-hand_8 EF-hand domain pair 1.1E-03 98 123
PF13833 EF-hand_8 EF-hand domain pair 1.5E-02 130 173

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Cell membrane Nuclear export signal 0.6348 0.2283 0.0444 0.7024 0.2179 0.0344 0.412 0.5398 0.5518 0.0152

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4899
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6647
Ophiocordyceps australis map64 (Brazil) OphauB2|5953
Ophiocordyceps camponoti-floridani Ophcf2|03976 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1876
Ophiocordyceps kimflemingae Ophio5|1357
Ophiocordyceps subramaniannii Hirsu2|1304

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03976
MGKSQSKLSQEQLVELQKSTHFDKKELQQWYKGFLKDCPSGMLTKDEFQKIYRQFFPFGDPSSFADYVFNVFDSD
KSGTIDFKEFICALSVTSRGKMEDKLDWAFQLYDIDGDGKISYDEMLQIVEAIYKMVGSMVKLPEDEDTPEKRVR
KIFRMMDKDENGSLDMEEFKEGSKRDETIVSALSLYDGLV*
Coding >Ophcf2|03976
ATGGGGAAATCACAGTCGAAACTCTCGCAAGAGCAACTCGTGGAGCTTCAGAAGTCGACCCACTTCGACAAGAAG
GAGCTGCAACAATGGTACAAGGGCTTCCTCAAGGACTGTCCGTCTGGGATGCTTACCAAGGACGAGTTTCAGAAG
ATTTACCGTCAATTCTTTCCATTTGGAGATCCGAGTTCGTTTGCCGACTATGTCTTTAACGTCTTCGATAGCGAC
AAGTCTGGGACCATTGACTTTAAGGAGTTTATCTGCGCTCTGAGCGTCACGAGCCGTGGAAAGATGGAGGATAAG
CTGGACTGGGCCTTTCAGCTGTACGACATTGACGGCGACGGCAAGATAAGCTACGACGAGATGCTACAGATTGTC
GAGGCCATCTACAAAATGGTGGGATCCATGGTCAAGCTACCCGAAGACGAAGACACGCCCGAGAAGCGAGTCCGC
AAGATCTTCCGCATGATGGACAAGGACGAGAACGGCTCTCTGGACATGGAGGAGTTTAAGGAGGGCAGCAAGCGG
GACGAGACGATTGTATCGGCGCTTTCACTGTACGACGGGCTCGTGTAG
Transcript >Ophcf2|03976
ATGGGGAAATCACAGTCGAAACTCTCGCAAGAGCAACTCGTGGAGCTTCAGAAGTCGACCCACTTCGACAAGAAG
GAGCTGCAACAATGGTACAAGGGCTTCCTCAAGGACTGTCCGTCTGGGATGCTTACCAAGGACGAGTTTCAGAAG
ATTTACCGTCAATTCTTTCCATTTGGAGATCCGAGTTCGTTTGCCGACTATGTCTTTAACGTCTTCGATAGCGAC
AAGTCTGGGACCATTGACTTTAAGGAGTTTATCTGCGCTCTGAGCGTCACGAGCCGTGGAAAGATGGAGGATAAG
CTGGACTGGGCCTTTCAGCTGTACGACATTGACGGCGACGGCAAGATAAGCTACGACGAGATGCTACAGATTGTC
GAGGCCATCTACAAAATGGTGGGATCCATGGTCAAGCTACCCGAAGACGAAGACACGCCCGAGAAGCGAGTCCGC
AAGATCTTCCGCATGATGGACAAGGACGAGAACGGCTCTCTGGACATGGAGGAGTTTAAGGAGGGCAGCAAGCGG
GACGAGACGATTGTATCGGCGCTTTCACTGTACGACGGGCTCGTGTAG
Gene >Ophcf2|03976
ATGGGGAAATCGTGAGTTGAGAATCCCGCTTCGTGTCCTTTCCCTTGTCTTATTTTTTTTTTTTTTTTTTTTTTT
TTCCTTGGTACGTTCCGGTGATCGCGGGCGAGAACCGAAGGGCGCTCAAACTGTCGTGCGGAATGTGCGAGATGG
CACGAGCACGGCCTGTCGTCCATGCGGCGGCTCGCTCCCACATGCTGGCCGGTCATGGCTAATGTCTCACAGACA
GTCGAAACTCTCGCAAGAGCAACTCGTGGAGCTTCAGAAGTCGACCCACTTCGACAAGAAGGAGCTGCAACAATG
GTACAAGGGTTGGTTCCGGTCCGAGATCCGCGGTTGTGTGTCACAAACGCAGGCTGACGATGCAAAAAAACTAGG
CTTCCTCAAGGACTGTCCGTCTGGGATGCTTACCAAGGACGAGTTTCAGAAGATTTACCGTCAATTCTTTCCATT
TGGAGATCCGAGTTCGTTTGCCGACTATGTCTTTAACGTCTTCGATAGCGACAAGTCTGGGACCATTGACTTTAA
GGAGTTTATCTGCGCTCTGAGCGTCACGAGCCGTGGAAAGATGGAGGATAAGCTGGACTGGGCCTTTCAGCTGTA
CGACATTGACGGCGACGGCAAGATAAGCTACGACGAGATGCTACAGATTGTCGAGGCCATCTACAAAATGGTGAG
CTTTCTTTTTTTTTGGTCTGTCGGTACGTGTCTGCTGATGCATACGTGCAGGTGGGATCCATGGTCAAGCTACCC
GAAGACGAAGACACGCCCGAGAAGCGAGTCCGCAAGATCTTCCGCATGATGGACAAGGACGAGAACGGCTCTCTG
GACATGGAGGAGTTTAAGGAGGGCAGCAAGCGGGACGAGACGATTGTATCGGCGCTTTCACTGTACGACGGGCTC
GTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail