Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03971
Gene name
Locationscaffold_04:520845..521455
Strand+
Gene length (bp)610
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02221 E1_DerP2_DerF2 ML domain 1.3E-26 31 155

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1023 0.0477 0.9249 0.0841 0.1116 0.0105 0.1677 0.2796 0.1268 0.0073

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999769

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup877
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6655
Ophiocordyceps australis map64 (Brazil) OphauB2|5947
Ophiocordyceps camponoti-floridani Ophcf2|03971 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5620
Ophiocordyceps kimflemingae Ophio5|2925
Ophiocordyceps subramaniannii Hirsu2|5086
Ophiocordyceps subramaniannii Hirsu2|7767

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03971
MRFYSTVALLCACLASAATVSESHQVPGGSPLQFCEGPIVRDFVDIKSVKLSPNPPQAGKNLTINAHGTVHKDIV
EGAYVRINVKWGLITLINTVQDLCEQTGHINLKCPIKAGDMTIEKSFGLPIAIPDGTYNVKADVFSQDDSHITCL
TASVTFHGNRLFNIEL*
Coding >Ophcf2|03971
ATGAGGTTCTACTCCACTGTCGCTCTCTTGTGCGCCTGCCTGGCTTCAGCGGCCACTGTCAGCGAGAGTCACCAG
GTCCCGGGGGGCTCTCCCCTGCAGTTCTGCGAGGGGCCTATTGTCAGAGACTTTGTCGACATCAAGAGCGTCAAG
CTTAGTCCCAACCCTCCTCAAGCGGGCAAGAATCTGACCATCAACGCTCACGGAACCGTCCACAAGGATATCGTC
GAGGGCGCCTACGTACGCATCAACGTCAAGTGGGGCCTCATCACCCTCATCAACACGGTGCAGGATCTCTGCGAG
CAGACGGGTCACATCAATCTCAAATGTCCTATCAAGGCTGGCGACATGACGATTGAGAAGTCGTTTGGGCTGCCC
ATCGCAATTCCTGATGGCACATACAACGTCAAGGCCGATGTCTTTTCCCAAGACGATAGCCACATCACCTGCTTG
ACCGCAAGCGTCACCTTCCACGGAAACAGATTATTCAACATCGAGCTCTAG
Transcript >Ophcf2|03971
ATGAGGTTCTACTCCACTGTCGCTCTCTTGTGCGCCTGCCTGGCTTCAGCGGCCACTGTCAGCGAGAGTCACCAG
GTCCCGGGGGGCTCTCCCCTGCAGTTCTGCGAGGGGCCTATTGTCAGAGACTTTGTCGACATCAAGAGCGTCAAG
CTTAGTCCCAACCCTCCTCAAGCGGGCAAGAATCTGACCATCAACGCTCACGGAACCGTCCACAAGGATATCGTC
GAGGGCGCCTACGTACGCATCAACGTCAAGTGGGGCCTCATCACCCTCATCAACACGGTGCAGGATCTCTGCGAG
CAGACGGGTCACATCAATCTCAAATGTCCTATCAAGGCTGGCGACATGACGATTGAGAAGTCGTTTGGGCTGCCC
ATCGCAATTCCTGATGGCACATACAACGTCAAGGCCGATGTCTTTTCCCAAGACGATAGCCACATCACCTGCTTG
ACCGCAAGCGTCACCTTCCACGGAAACAGATTATTCAACATCGAGCTCTAG
Gene >Ophcf2|03971
ATGAGGTTCTACTCCACTGTCGCTCTCTTGTGCGCCTGCCTGGCTTCAGCGGCCACTGTCAGCGAGAGTCACCAG
GTCCCGGGGGGCTCTCCCCTGCAGTTCTGCGAGGGGCCTATTGTCAGAGACTTTGTCGACATCAAGAGCGTCAAG
CTTAGTCCCAACCCTCCTCAAGCGTAAGGCGGGCCTCTCATTCAAGCACGTCATCGCAGATCGCTGACTATCTGC
TATCCAGGGGCAAGAATCTGACCATCAACGCTCACGGAACCGTCCACAAGGATATCGTCGAGGGCGCCTACGTAC
GCATCAACGTCAAGTGGGGCCTCATCACCCTCATCAACACGGTGCAGGATCTCTGCGAGCAGACGGGTCACATCA
ATCTCAAATGTCCTATCAAGGCTGGCGACATGACGATTGAGAAGTCGTTTGGGCTGCCCATCGCAATTCCTGATG
TGCGCGGCCTCCCACTATCACTTGTGACGTCAGACTGACTTGCTGGTAGGGCACATACAACGTCAAGGCCGATGT
CTTTTCCCAAGACGATAGCCACATCACCTGCTTGACCGCAAGCGTCACCTTCCACGGAAACAGATTATTCAACAT
CGAGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail