Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03967
Gene name
Locationscaffold_04:509561..511535
Strand+
Gene length (bp)1974
Transcript length (bp)1974
Coding sequence length (bp)1974
Protein length (aa) 658

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01841 Transglut_core Transglutaminase-like superfamily 3.1E-10 349 455

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6522 0.2529 0.1114 0.1555 0.0953 0.0054 0.0849 0.1049 0.0787 0.0405

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3470
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6660
Ophiocordyceps australis map64 (Brazil) OphauB2|5944
Ophiocordyceps camponoti-floridani Ophcf2|03967 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6496
Ophiocordyceps kimflemingae Ophio5|2921
Ophiocordyceps subramaniannii Hirsu2|663

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03967
MAEVEEVQFNSLADRIAALGKQKNFNPGAEPVRKRPPPPPPPTAKPVVRVDDQTAVSPPPGPVRPCPPPPPARRD
GRPPPPPPPVRSSTASRPVPPPLPRRTSTQSGAMVLRRDSNSSEASQQSVLSPFSPGRKSSTMSLRSQEGSRPRS
MAPAACDPANLPPLPPSRRESEVKVKEAKAQRMAMARVPSTPTSPASPPKPTLPPRLPSRPASKADVAGSATNVL
DQAKKAARKLPPTVIRGFSSSTSTPTTTSAPTKAPSKAPVDDDDDAAPPPLPLSSRPSAAEIDAVSTRAMATTTS
TQPQQADCWICRDWSDPDGVAAQYPRAPLPRNDPVGYLARALCDPFPSYTDKARAIFTWFHHNILYDTEAFFGNN
VRHKSVEDTIFTGKAVCQGYAETYKAIANRAGLDCIVVGGHGKGFGHVALKKGQRPPPAKPDGHAWNAVRIDGGD
WKLIDACWGAGHISGADQTYKKEFAPEQFTRSNEKFGLRHFPQKPSHQFRSDGRVISWEEYYRGPSDGEPPVFFT
DGHREGIAEDSVSPREREIAVHSGQVIRFQFSKVCEHWTSEKNGLGPPPLLLLSIHGVDGGRDDLVPMESNGFWH
WVDVRACDLGAPGQSVEVVQVTQMDGRDARGVTAGEFVAKRGRVGMAWSYVMKWELV*
Coding >Ophcf2|03967
ATGGCGGAAGTCGAGGAAGTTCAGTTCAACTCCCTCGCCGATCGCATCGCTGCTCTCGGCAAGCAAAAGAACTTT
AACCCCGGCGCCGAACCCGTTCGCAAGAGACCACCGCCTCCTCCTCCCCCTACGGCCAAGCCGGTCGTGCGGGTC
GATGATCAGACGGCCGTGTCTCCGCCTCCGGGTCCGGTGAGACCCTGTCCGCCTCCACCTCCGGCCCGTCGCGAT
GGCCGTCCTCCGCCGCCGCCTCCGCCCGTCCGATCGTCGACGGCGTCTCGTCCGGTGCCGCCTCCGCTGCCTCGT
CGGACTTCGACACAGTCCGGCGCCATGGTGCTGAGGCGTGACTCGAATTCGTCCGAGGCGTCGCAGCAGTCGGTC
CTGTCGCCTTTTTCACCTGGTCGAAAATCGTCTACTATGAGCTTGAGGTCTCAAGAAGGCTCGCGTCCACGAAGC
ATGGCCCCGGCAGCCTGCGACCCGGCCAACTTGCCCCCGCTGCCGCCATCGAGAAGAGAGTCAGAGGTCAAGGTC
AAGGAGGCCAAGGCGCAGCGCATGGCCATGGCCAGAGTCCCTTCCACTCCTACCAGCCCAGCCTCGCCACCGAAG
CCCACTCTCCCGCCCAGATTGCCGTCGCGGCCCGCATCAAAGGCCGACGTCGCTGGCTCGGCTACAAATGTCTTG
GACCAGGCCAAGAAGGCGGCTAGGAAATTACCTCCCACAGTCATCAGGGGGTTCAGCAGCAGTACGTCGACGCCG
ACGACGACGTCCGCTCCTACGAAAGCTCCTTCGAAGGCTCCCGTCGATGACGACGACGATGCCGCTCCTCCGCCG
CTGCCCCTCAGCTCGCGACCTTCGGCGGCCGAGATCGACGCTGTATCGACGAGGGCGATGGCGACAACGACCAGC
ACTCAGCCACAGCAGGCCGACTGTTGGATCTGTCGGGACTGGAGTGACCCCGACGGCGTTGCGGCGCAATATCCC
AGAGCACCTCTCCCTCGCAACGATCCGGTCGGATACTTGGCCCGCGCGCTCTGCGACCCGTTCCCATCGTACACG
GACAAGGCCAGAGCCATCTTCACCTGGTTTCACCACAACATCTTGTACGACACCGAGGCCTTTTTCGGCAACAAT
GTGCGGCACAAGTCGGTCGAGGACACCATCTTCACGGGCAAAGCCGTCTGCCAGGGATACGCCGAGACGTACAAG
GCGATTGCAAACCGAGCCGGACTAGACTGCATCGTCGTAGGCGGTCACGGCAAAGGCTTCGGCCACGTGGCGCTG
AAGAAGGGTCAGAGGCCACCGCCAGCCAAGCCAGACGGCCACGCATGGAATGCGGTCCGCATCGACGGCGGCGAC
TGGAAACTCATCGACGCCTGCTGGGGAGCGGGACACATCTCTGGAGCAGACCAGACGTACAAGAAGGAATTCGCA
CCGGAGCAGTTCACGCGCAGCAACGAAAAGTTCGGCCTCCGACACTTTCCTCAGAAGCCGAGCCACCAGTTCCGC
TCCGACGGACGGGTAATCTCGTGGGAAGAATACTATCGCGGCCCCTCCGACGGCGAGCCCCCCGTCTTCTTCACA
GACGGACACCGCGAGGGCATCGCCGAAGACAGCGTCTCCCCACGCGAGCGAGAAATCGCCGTCCACAGCGGACAG
GTAATCCGCTTCCAGTTCTCCAAGGTATGCGAGCACTGGACGTCGGAGAAGAACGGGCTCGGACCCCCCCCACTG
CTCCTCCTCAGCATCCACGGCGTCGACGGCGGAAGAGATGACTTGGTTCCGATGGAGAGCAATGGCTTCTGGCAT
TGGGTTGATGTTCGGGCTTGTGATTTGGGGGCGCCGGGTCAGTCGGTTGAGGTGGTGCAGGTTACGCAGATGGAT
GGGCGGGATGCGCGGGGGGTTACGGCGGGGGAGTTTGTTGCTAAGAGGGGGAGGGTTGGGATGGCGTGGTCGTAC
GTGATGAAGTGGGAGCTTGTGTGA
Transcript >Ophcf2|03967
ATGGCGGAAGTCGAGGAAGTTCAGTTCAACTCCCTCGCCGATCGCATCGCTGCTCTCGGCAAGCAAAAGAACTTT
AACCCCGGCGCCGAACCCGTTCGCAAGAGACCACCGCCTCCTCCTCCCCCTACGGCCAAGCCGGTCGTGCGGGTC
GATGATCAGACGGCCGTGTCTCCGCCTCCGGGTCCGGTGAGACCCTGTCCGCCTCCACCTCCGGCCCGTCGCGAT
GGCCGTCCTCCGCCGCCGCCTCCGCCCGTCCGATCGTCGACGGCGTCTCGTCCGGTGCCGCCTCCGCTGCCTCGT
CGGACTTCGACACAGTCCGGCGCCATGGTGCTGAGGCGTGACTCGAATTCGTCCGAGGCGTCGCAGCAGTCGGTC
CTGTCGCCTTTTTCACCTGGTCGAAAATCGTCTACTATGAGCTTGAGGTCTCAAGAAGGCTCGCGTCCACGAAGC
ATGGCCCCGGCAGCCTGCGACCCGGCCAACTTGCCCCCGCTGCCGCCATCGAGAAGAGAGTCAGAGGTCAAGGTC
AAGGAGGCCAAGGCGCAGCGCATGGCCATGGCCAGAGTCCCTTCCACTCCTACCAGCCCAGCCTCGCCACCGAAG
CCCACTCTCCCGCCCAGATTGCCGTCGCGGCCCGCATCAAAGGCCGACGTCGCTGGCTCGGCTACAAATGTCTTG
GACCAGGCCAAGAAGGCGGCTAGGAAATTACCTCCCACAGTCATCAGGGGGTTCAGCAGCAGTACGTCGACGCCG
ACGACGACGTCCGCTCCTACGAAAGCTCCTTCGAAGGCTCCCGTCGATGACGACGACGATGCCGCTCCTCCGCCG
CTGCCCCTCAGCTCGCGACCTTCGGCGGCCGAGATCGACGCTGTATCGACGAGGGCGATGGCGACAACGACCAGC
ACTCAGCCACAGCAGGCCGACTGTTGGATCTGTCGGGACTGGAGTGACCCCGACGGCGTTGCGGCGCAATATCCC
AGAGCACCTCTCCCTCGCAACGATCCGGTCGGATACTTGGCCCGCGCGCTCTGCGACCCGTTCCCATCGTACACG
GACAAGGCCAGAGCCATCTTCACCTGGTTTCACCACAACATCTTGTACGACACCGAGGCCTTTTTCGGCAACAAT
GTGCGGCACAAGTCGGTCGAGGACACCATCTTCACGGGCAAAGCCGTCTGCCAGGGATACGCCGAGACGTACAAG
GCGATTGCAAACCGAGCCGGACTAGACTGCATCGTCGTAGGCGGTCACGGCAAAGGCTTCGGCCACGTGGCGCTG
AAGAAGGGTCAGAGGCCACCGCCAGCCAAGCCAGACGGCCACGCATGGAATGCGGTCCGCATCGACGGCGGCGAC
TGGAAACTCATCGACGCCTGCTGGGGAGCGGGACACATCTCTGGAGCAGACCAGACGTACAAGAAGGAATTCGCA
CCGGAGCAGTTCACGCGCAGCAACGAAAAGTTCGGCCTCCGACACTTTCCTCAGAAGCCGAGCCACCAGTTCCGC
TCCGACGGACGGGTAATCTCGTGGGAAGAATACTATCGCGGCCCCTCCGACGGCGAGCCCCCCGTCTTCTTCACA
GACGGACACCGCGAGGGCATCGCCGAAGACAGCGTCTCCCCACGCGAGCGAGAAATCGCCGTCCACAGCGGACAG
GTAATCCGCTTCCAGTTCTCCAAGGTATGCGAGCACTGGACGTCGGAGAAGAACGGGCTCGGACCCCCCCCACTG
CTCCTCCTCAGCATCCACGGCGTCGACGGCGGAAGAGATGACTTGGTTCCGATGGAGAGCAATGGCTTCTGGCAT
TGGGTTGATGTTCGGGCTTGTGATTTGGGGGCGCCGGGTCAGTCGGTTGAGGTGGTGCAGGTTACGCAGATGGAT
GGGCGGGATGCGCGGGGGGTTACGGCGGGGGAGTTTGTTGCTAAGAGGGGGAGGGTTGGGATGGCGTGGTCGTAC
GTGATGAAGTGGGAGCTTGTGTGA
Gene >Ophcf2|03967
ATGGCGGAAGTCGAGGAAGTTCAGTTCAACTCCCTCGCCGATCGCATCGCTGCTCTCGGCAAGCAAAAGAACTTT
AACCCCGGCGCCGAACCCGTTCGCAAGAGACCACCGCCTCCTCCTCCCCCTACGGCCAAGCCGGTCGTGCGGGTC
GATGATCAGACGGCCGTGTCTCCGCCTCCGGGTCCGGTGAGACCCTGTCCGCCTCCACCTCCGGCCCGTCGCGAT
GGCCGTCCTCCGCCGCCGCCTCCGCCCGTCCGATCGTCGACGGCGTCTCGTCCGGTGCCGCCTCCGCTGCCTCGT
CGGACTTCGACACAGTCCGGCGCCATGGTGCTGAGGCGTGACTCGAATTCGTCCGAGGCGTCGCAGCAGTCGGTC
CTGTCGCCTTTTTCACCTGGTCGAAAATCGTCTACTATGAGCTTGAGGTCTCAAGAAGGCTCGCGTCCACGAAGC
ATGGCCCCGGCAGCCTGCGACCCGGCCAACTTGCCCCCGCTGCCGCCATCGAGAAGAGAGTCAGAGGTCAAGGTC
AAGGAGGCCAAGGCGCAGCGCATGGCCATGGCCAGAGTCCCTTCCACTCCTACCAGCCCAGCCTCGCCACCGAAG
CCCACTCTCCCGCCCAGATTGCCGTCGCGGCCCGCATCAAAGGCCGACGTCGCTGGCTCGGCTACAAATGTCTTG
GACCAGGCCAAGAAGGCGGCTAGGAAATTACCTCCCACAGTCATCAGGGGGTTCAGCAGCAGTACGTCGACGCCG
ACGACGACGTCCGCTCCTACGAAAGCTCCTTCGAAGGCTCCCGTCGATGACGACGACGATGCCGCTCCTCCGCCG
CTGCCCCTCAGCTCGCGACCTTCGGCGGCCGAGATCGACGCTGTATCGACGAGGGCGATGGCGACAACGACCAGC
ACTCAGCCACAGCAGGCCGACTGTTGGATCTGTCGGGACTGGAGTGACCCCGACGGCGTTGCGGCGCAATATCCC
AGAGCACCTCTCCCTCGCAACGATCCGGTCGGATACTTGGCCCGCGCGCTCTGCGACCCGTTCCCATCGTACACG
GACAAGGCCAGAGCCATCTTCACCTGGTTTCACCACAACATCTTGTACGACACCGAGGCCTTTTTCGGCAACAAT
GTGCGGCACAAGTCGGTCGAGGACACCATCTTCACGGGCAAAGCCGTCTGCCAGGGATACGCCGAGACGTACAAG
GCGATTGCAAACCGAGCCGGACTAGACTGCATCGTCGTAGGCGGTCACGGCAAAGGCTTCGGCCACGTGGCGCTG
AAGAAGGGTCAGAGGCCACCGCCAGCCAAGCCAGACGGCCACGCATGGAATGCGGTCCGCATCGACGGCGGCGAC
TGGAAACTCATCGACGCCTGCTGGGGAGCGGGACACATCTCTGGAGCAGACCAGACGTACAAGAAGGAATTCGCA
CCGGAGCAGTTCACGCGCAGCAACGAAAAGTTCGGCCTCCGACACTTTCCTCAGAAGCCGAGCCACCAGTTCCGC
TCCGACGGACGGGTAATCTCGTGGGAAGAATACTATCGCGGCCCCTCCGACGGCGAGCCCCCCGTCTTCTTCACA
GACGGACACCGCGAGGGCATCGCCGAAGACAGCGTCTCCCCACGCGAGCGAGAAATCGCCGTCCACAGCGGACAG
GTAATCCGCTTCCAGTTCTCCAAGGTATGCGAGCACTGGACGTCGGAGAAGAACGGGCTCGGACCCCCCCCACTG
CTCCTCCTCAGCATCCACGGCGTCGACGGCGGAAGAGATGACTTGGTTCCGATGGAGAGCAATGGCTTCTGGCAT
TGGGTTGATGTTCGGGCTTGTGATTTGGGGGCGCCGGGTCAGTCGGTTGAGGTGGTGCAGGTTACGCAGATGGAT
GGGCGGGATGCGCGGGGGGTTACGGCGGGGGAGTTTGTTGCTAAGAGGGGGAGGGTTGGGATGGCGTGGTCGTAC
GTGATGAAGTGGGAGCTTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail