Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03966
Gene name
Locationscaffold_04:507603..508902
Strand-
Gene length (bp)1299
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12511 DUF3716 Protein of unknown function (DUF3716) 1.8E-15 202 255

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2464 0.9238 0.1715 0.0266 0.0557 0.0044 0.0248 0.0291 0.01 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7367
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03966 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6497
Ophiocordyceps kimflemingae Ophio5|2920

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03966
MSTLEASPERPARFRGRNIVLDEEDIDGMTEPPSRGVTPREAEEPPSRRNTPIETEGPLFRGHTPDGTEQPPSRW
PTPGVTEQPPSRENTPGEAGPHSRRDTSDEMEEPTSTGDTPNESEPSSTPGTPSEYVQGSSSDSSCDTSGPKRKP
LAKKFNTRLLKCPGKFSTNMVRMLRLKPQRQVQYRPGKEEGVNLRRLKNCEALLLQTMGEEAESPCARCNDGRGP
FEDCVRIPDMLQGCCGNCLYNSYSTECCFHVGRGQDTTARQTTRAFTGKRKAPRYSVSSGSPPDAQTTPRRVTRN
SSGHSAAATDRSNRISTTQNATPGSRSLWAADLEYITQQNKRARVLPSLDPTVSDHMDCMRRELRQEMRRAVDKA
VDRVRDEIGGQVDLLTQRLDDMGFRHDDDLAAIVRTMRTLAERG*
Coding >Ophcf2|03966
ATGTCGACACTGGAAGCCTCGCCGGAGCGACCTGCTCGCTTCAGGGGAAGGAACATTGTTCTTGATGAAGAAGAT
ATTGATGGCATGACCGAGCCGCCTTCGAGGGGGGTCACACCTCGCGAGGCGGAGGAGCCACCCTCGAGGCGAAAC
ACGCCCATCGAGACGGAGGGGCCTCTTTTCAGGGGGCACACCCCCGACGGTACTGAGCAGCCGCCATCGAGGTGG
CCCACGCCAGGCGTCACTGAGCAGCCGCCTTCGAGAGAAAACACGCCCGGCGAGGCTGGGCCGCATTCGAGGCGG
GACACGTCGGACGAGATGGAGGAGCCGACTTCTACCGGGGACACGCCCAACGAGTCTGAGCCGTCTTCCACACCG
GGCACGCCCAGCGAATATGTCCAGGGCAGTTCATCCGACTCGAGCTGTGATACATCGGGACCCAAAAGGAAGCCC
CTCGCCAAAAAGTTCAACACGCGACTTCTCAAATGTCCAGGGAAGTTCTCCACTAACATGGTGCGCATGTTGCGA
CTCAAACCTCAACGTCAGGTCCAGTACAGGCCGGGCAAAGAGGAGGGGGTGAATCTCCGGAGGCTGAAGAACTGC
GAGGCCTTGCTTTTGCAGACCATGGGAGAGGAGGCAGAGTCACCATGTGCTCGTTGCAACGACGGACGTGGGCCC
TTTGAAGACTGTGTTCGGATCCCCGACATGTTGCAGGGATGTTGCGGCAACTGTCTTTACAACTCGTACAGCACC
GAATGTTGCTTCCATGTCGGCAGAGGACAAGACACGACGGCTCGGCAGACGACAAGGGCCTTTACCGGGAAGCGC
AAAGCGCCACGTTACTCTGTGTCGTCAGGGTCGCCTCCCGATGCACAGACGACGCCTCGACGAGTTACCAGGAAT
TCGTCGGGCCACAGTGCAGCAGCTACGGATCGATCTAACCGCATCTCGACGACGCAGAACGCGACTCCGGGTAGC
CGTTCTCTTTGGGCCGCCGATCTCGAGTACATCACCCAGCAGAACAAACGAGCGCGGGTACTTCCGTCTTTGGAC
CCGACTGTGAGCGACCACATGGACTGTATGCGACGGGAGCTTCGGCAAGAAATGCGCCGCGCTGTCGACAAAGCC
GTGGATCGTGTGCGAGATGAAATTGGCGGCCAGGTCGATCTGCTGACCCAGCGATTGGACGATATGGGCTTCCGC
CACGATGACGATCTGGCCGCCATTGTGAGGACGATGCGGACTCTCGCCGAGCGGGGATGA
Transcript >Ophcf2|03966
ATGTCGACACTGGAAGCCTCGCCGGAGCGACCTGCTCGCTTCAGGGGAAGGAACATTGTTCTTGATGAAGAAGAT
ATTGATGGCATGACCGAGCCGCCTTCGAGGGGGGTCACACCTCGCGAGGCGGAGGAGCCACCCTCGAGGCGAAAC
ACGCCCATCGAGACGGAGGGGCCTCTTTTCAGGGGGCACACCCCCGACGGTACTGAGCAGCCGCCATCGAGGTGG
CCCACGCCAGGCGTCACTGAGCAGCCGCCTTCGAGAGAAAACACGCCCGGCGAGGCTGGGCCGCATTCGAGGCGG
GACACGTCGGACGAGATGGAGGAGCCGACTTCTACCGGGGACACGCCCAACGAGTCTGAGCCGTCTTCCACACCG
GGCACGCCCAGCGAATATGTCCAGGGCAGTTCATCCGACTCGAGCTGTGATACATCGGGACCCAAAAGGAAGCCC
CTCGCCAAAAAGTTCAACACGCGACTTCTCAAATGTCCAGGGAAGTTCTCCACTAACATGGTGCGCATGTTGCGA
CTCAAACCTCAACGTCAGGTCCAGTACAGGCCGGGCAAAGAGGAGGGGGTGAATCTCCGGAGGCTGAAGAACTGC
GAGGCCTTGCTTTTGCAGACCATGGGAGAGGAGGCAGAGTCACCATGTGCTCGTTGCAACGACGGACGTGGGCCC
TTTGAAGACTGTGTTCGGATCCCCGACATGTTGCAGGGATGTTGCGGCAACTGTCTTTACAACTCGTACAGCACC
GAATGTTGCTTCCATGTCGGCAGAGGACAAGACACGACGGCTCGGCAGACGACAAGGGCCTTTACCGGGAAGCGC
AAAGCGCCACGTTACTCTGTGTCGTCAGGGTCGCCTCCCGATGCACAGACGACGCCTCGACGAGTTACCAGGAAT
TCGTCGGGCCACAGTGCAGCAGCTACGGATCGATCTAACCGCATCTCGACGACGCAGAACGCGACTCCGGGTAGC
CGTTCTCTTTGGGCCGCCGATCTCGAGTACATCACCCAGCAGAACAAACGAGCGCGGGTACTTCCGTCTTTGGAC
CCGACTGTGAGCGACCACATGGACTGTATGCGACGGGAGCTTCGGCAAGAAATGCGCCGCGCTGTCGACAAAGCC
GTGGATCGTGTGCGAGATGAAATTGGCGGCCAGGTCGATCTGCTGACCCAGCGATTGGACGATATGGGCTTCCGC
CACGATGACGATCTGGCCGCCATTGTGAGGACGATGCGGACTCTCGCCGAGCGGGGATGA
Gene >Ophcf2|03966
ATGTCGACACTGGAAGCCTCGCCGGAGCGACCTGCTCGCTTCAGGGGAAGGAACATTGTTCTTGATGAAGAAGAT
ATTGATGGCATGACCGAGCCGCCTTCGAGGGGGGTCACACCTCGCGAGGCGGAGGAGCCACCCTCGAGGCGGGAC
ACGCCCAGCGGGCTTGAGCAGCCGGCTTCGAGGCGAAACACGCCCATCGAGACGGAGGGGCCTCTTTTCAGGGGG
CACACCCCCGACGGTACTGAGCAGCCGCCATCGAGGTGGCCCACGCCAGGCGTCACTGAGCAGCCGCCTTCGAGA
GAAAACACGCCCGGCGAGGCTGGGCCGCATTCGAGGCGGGACACGTCGGACGAGATGGAGGAGCCGACTTCTACC
GGGGACACGCCCAACGAGTCTGAGCCGTCTTCCACACCGGGCACGCCCAGCGAATATGTCCAGGGCAGTTCATCC
GACTCGAGCTGTGATACATCGGGACCCAAAAGGAAGCCCCTCGCCAAAAAGTTCAACACGCGACTTCTCAAATGT
CCAGGGAAGTTCTCCACTAACATGGTGCGCATGTTGCGACTCAAACCTCAACGTCAGGTCCAGTACAGGCCGGGC
AAAGAGGAGGGGGTGAATCTCCGGAGGCTGAAGAACTGCGAGGCCTTGCTTTTGCAGACCATGGGAGAGGAGGCA
GAGTCACCATGTGCTCGTTGCAACGACGGACGTGGGCCCTTTGAAGACTGTGTTCGGATCCCCGACATGTTGCAG
GGATGTTGCGGCAACTGTCTTTACAACTCGTACAGCACCGAATGTTGCTTCCATGTCGGCAGAGGACAAGACACG
ACGGCTCGGCAGACGACAAGGGCCTTTACCGGGAAGCGCAAAGCGCCACGTTACTCTGTGTCGTCAGGGTCGCCT
CCCGATGCACAGACGACGCCTCGACGAGTTACCAGGAATTCGTCGGGCCACAGTGCAGCAGCTACGGATCGATCT
AACCGCATCTCGACGACGCAGAACGCGACTCCGGGTAGCCGTTCTCTTTGGGCCGCCGATCTCGAGTACATCACC
CAGCAGAACAAACGAGCGCGGGTACTTCCGTCTTTGGACCCGACTGTGAGCGACCACATGGACTGTATGCGACGG
GAGCTTCGGCAAGAAATGCGCCGCGCTGTCGACAAAGCCGTGGATCGTGTGCGAGATGAAATTGGCGGCCAGGTC
GATCTGCTGACCCAGCGATTGGACGATATGGGCTTCCGCCACGATGACGATCTGGCCGCCATTGTGAGGACGATG
CGGACTCTCGCCGAGCGGGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail