Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03963
Gene name
Locationscaffold_04:500665..502027
Strand+
Gene length (bp)1362
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 1.2E-98 49 371

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1469 0.1018 0.0209 0.0546 0.9618 0.0431 0.0509 0.0293 0.0744 0.0095

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2305
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6604
Ophiocordyceps australis map64 (Brazil) OphauB2|5941
Ophiocordyceps camponoti-floridani Ophcf2|03963 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6374
Ophiocordyceps kimflemingae Ophio5|7792
Ophiocordyceps subramaniannii Hirsu2|3086

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03963
MLALRASSRALSRPCLRVAVRSASRFYSSGGERVAKYEGTKNSEGNYLVSLIEGDGIGPEISQSVKDIFAAAKTP
VAWESVDVTPILKDGKTAIPDDAIASIRKNKIALKGPLATPVGKGHVSLNLTLRRTFNLFANLRPCRSVAGFKTP
YDDVDTVLIRENTEGEYSGIEHIVVDGVVQSIKLITREASERVLRFAFQHAEAIGRNKVRVVHKATIMKMSDGLF
LSVARQVAKDFPNIEFDAELLDNTCLKMVTDPDPYNDKVLVMPNLYGDILSDMCAGLIGGLGLTPSGNIGDECSI
FEAVHGSAPDIAGKGLANPTALLLSSIMMLRHMRLNDHAGRIEKAIFDTLAEGKALTGDLGGKAKTHEYAAAIIS
KL*
Coding >Ophcf2|03963
ATGCTGGCCCTCCGCGCCTCATCCCGGGCCCTCAGCCGGCCGTGTCTTCGCGTCGCCGTCCGGTCAGCCTCGCGC
TTCTACTCGTCTGGGGGCGAACGGGTCGCCAAGTACGAGGGCACCAAGAACTCAGAGGGCAACTATCTCGTTAGC
CTGATCGAGGGTGACGGCATTGGCCCCGAAATCTCGCAGTCGGTCAAGGACATCTTCGCTGCTGCCAAGACGCCC
GTCGCATGGGAGTCGGTCGACGTGACACCCATCCTCAAAGATGGAAAGACGGCGATTCCGGATGACGCCATTGCC
AGCATCCGCAAGAACAAGATTGCCCTCAAGGGTCCTCTGGCTACACCCGTCGGCAAGGGTCACGTCTCGCTCAAC
CTCACGCTTCGTCGGACATTCAACCTGTTTGCCAACCTGCGGCCTTGCCGATCGGTAGCCGGCTTCAAGACGCCC
TACGACGATGTCGACACGGTTCTAATCCGAGAGAACACCGAGGGCGAATACTCGGGTATCGAGCACATCGTCGTC
GACGGCGTGGTGCAGAGCATCAAGCTCATCACACGCGAGGCCAGCGAGCGCGTCCTTCGGTTCGCCTTCCAACAC
GCCGAGGCCATCGGCCGCAACAAGGTGCGCGTCGTGCACAAGGCCACCATCATGAAGATGTCGGACGGTCTCTTC
CTCAGCGTAGCACGACAGGTAGCCAAGGACTTCCCCAACATCGAGTTCGACGCCGAGCTGCTGGACAACACGTGT
CTCAAGATGGTGACGGATCCGGACCCCTACAACGACAAGGTGCTCGTCATGCCCAACCTATACGGTGACATCCTG
TCCGACATGTGCGCCGGCCTCATCGGCGGTCTCGGCCTGACGCCGTCGGGCAACATTGGCGACGAGTGCTCCATC
TTCGAGGCCGTCCACGGCTCGGCGCCAGACATCGCTGGCAAGGGTCTGGCTAATCCGACAGCGCTGCTGCTCAGC
TCCATCATGATGCTGCGGCACATGCGGCTCAACGACCACGCCGGCCGGATCGAAAAGGCCATCTTCGACACGCTC
GCCGAGGGCAAGGCCTTGACTGGTGATTTGGGCGGCAAGGCCAAGACGCACGAGTACGCGGCGGCCATCATCAGC
AAGCTATAG
Transcript >Ophcf2|03963
ATGCTGGCCCTCCGCGCCTCATCCCGGGCCCTCAGCCGGCCGTGTCTTCGCGTCGCCGTCCGGTCAGCCTCGCGC
TTCTACTCGTCTGGGGGCGAACGGGTCGCCAAGTACGAGGGCACCAAGAACTCAGAGGGCAACTATCTCGTTAGC
CTGATCGAGGGTGACGGCATTGGCCCCGAAATCTCGCAGTCGGTCAAGGACATCTTCGCTGCTGCCAAGACGCCC
GTCGCATGGGAGTCGGTCGACGTGACACCCATCCTCAAAGATGGAAAGACGGCGATTCCGGATGACGCCATTGCC
AGCATCCGCAAGAACAAGATTGCCCTCAAGGGTCCTCTGGCTACACCCGTCGGCAAGGGTCACGTCTCGCTCAAC
CTCACGCTTCGTCGGACATTCAACCTGTTTGCCAACCTGCGGCCTTGCCGATCGGTAGCCGGCTTCAAGACGCCC
TACGACGATGTCGACACGGTTCTAATCCGAGAGAACACCGAGGGCGAATACTCGGGTATCGAGCACATCGTCGTC
GACGGCGTGGTGCAGAGCATCAAGCTCATCACACGCGAGGCCAGCGAGCGCGTCCTTCGGTTCGCCTTCCAACAC
GCCGAGGCCATCGGCCGCAACAAGGTGCGCGTCGTGCACAAGGCCACCATCATGAAGATGTCGGACGGTCTCTTC
CTCAGCGTAGCACGACAGGTAGCCAAGGACTTCCCCAACATCGAGTTCGACGCCGAGCTGCTGGACAACACGTGT
CTCAAGATGGTGACGGATCCGGACCCCTACAACGACAAGGTGCTCGTCATGCCCAACCTATACGGTGACATCCTG
TCCGACATGTGCGCCGGCCTCATCGGCGGTCTCGGCCTGACGCCGTCGGGCAACATTGGCGACGAGTGCTCCATC
TTCGAGGCCGTCCACGGCTCGGCGCCAGACATCGCTGGCAAGGGTCTGGCTAATCCGACAGCGCTGCTGCTCAGC
TCCATCATGATGCTGCGGCACATGCGGCTCAACGACCACGCCGGCCGGATCGAAAAGGCCATCTTCGACACGCTC
GCCGAGGGCAAGGCCTTGACTGGTGATTTGGGCGGCAAGGCCAAGACGCACGAGTACGCGGCGGCCATCATCAGC
AAGCTATAG
Gene >Ophcf2|03963
ATGCTGGCCCTCCGCGCCTCATCCCGGGCCCTCAGCCGGCCGTGTCTTCGCGTCGCCGTCCGGTCAGCCTCGGTA
CGGGATAGCCGAGTCCCGGTGCCGTAGACGGACCCAGCTGACGTTTCCCGCGGCGGTTTGCAGCGCTTCTACTCG
TCTGGGGGCGAACGGGTCGCCAAGTACGAGGGCACCAAGAACTCAGAGGTTCGGCCTTGATGACGGACCAAGCAC
AGCTCTGTTTACTCACCCGTGACGACAGGGCAACTATCTCGTTAGCCTGATCGAGGGTGACGGCATTGGCCCCGA
AATCTCGCAGTCGGTCAAGGACATCTTCGCTGCTGCCAAGGTCTGCGCTCGTCGTCAGAAAATCCTCGACTTGAC
TGACGTATGAGACAGACGCCCGTCGCATGGGAGTCGGTCGACGTGACACCCATCCTCAAAGATGGAAAGACGGCG
ATTCCGGATGACGCCATTGCCAGCATCCGCAAGAACAAGATTGCCCTCAAGGGTCCTCTGGCTGTATGCTGGGCC
CGATATCGGCTTTTCATCGTCGTCAGCTGATGGTCTACTTCCCAGACACCCGTCGGCAAGGGTCACGTCTCGCTC
AACCTCACGCTTCGTCGGACATTCAACCTGTTTGCCAACCTGCGGCCTTGCCGATCGGTAGCCGGCTTCAAGACG
CCCTACGACGATGTCGACACGGTTCTAATCCGAGAGAACACCGAGGGCGAATACTCGGGTATCGAGCACATCGTC
GTCGACGGCGTGGTGCAGAGCATCAAGCTCATCACACGCGAGGCCAGCGAGCGCGTCCTTCGGTTCGCCTTCCAA
CACGCCGAGGCCATCGGCCGCAACAAGGTGCGCGTCGTGCACAAGGCCACCATCATGAAGATGTCGGACGGTCTC
TTCCTCAGCGTAGCACGACAGGTAGCCAAGGACTTCCCCAACATCGAGTTCGACGCCGAGCTGCTGGACAACACG
TGTCTCAAGATGGTGACGGATCCGGACCCCTACAACGACAAGGTGCTCGTCATGCCCAACCTATACGGTGACATC
CTGTCCGACATGTGCGCCGGCCTCATCGGCGGTCTCGGCCTGACGCCGTCGGGCAACATTGGCGACGAGTGCTCC
ATCTTCGAGGCCGTCCACGGCTCGGCGCCAGACATCGCTGGCAAGGGTCTGGCTAATCCGACAGCGCTGCTGCTC
AGCTCCATCATGATGCTGCGGCACATGCGGCTCAACGACCACGCCGGCCGGATCGAAAAGGCCATCTTCGACACG
CTCGCCGAGGGCAAGGCCTTGACTGGTGATTTGGGCGGCAAGGCCAAGACGCACGAGTACGCGGCGGCCATCATC
AGCAAGCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail