Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03960
Gene name
Locationscaffold_04:491534..493335
Strand+
Gene length (bp)1801
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03619 Solute_trans_a Organic solute transporter Ostalpha 7.5E-94 16 283

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 15 36 21
2 49 71 22
3 86 108 22
4 147 166 19
5 181 203 22
6 216 238 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 34.21 18.87 49.56
Alive In ants, during behavior modification 61.49 34.89 88.09
Dead In ants, recently dead 62.05 35.39 88.72

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001226 yes
Alive Dead 0.964075 no
Dead Fungus 0.000851 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03960
MMASGGTGQKFTYATTVVAGVASLAATLLSVLSIWLQAKNYRKPLLQRYVIRILVMVPIYSIASWASMVSSTTAA
FLDPIRDIYEAFTIYTFFQLLINYLGGERALIIMTHGRAPVQHLWPLNHVLRPVDISDPHSFLSIKRGILQYAWL
KPLLSLATIIMKATGTYQEGYIGAGSGYLWSGIIYNISVTVSLYSLGLFWVCMHHDLQPFRPVPKFLCIKLIIFA
SYWQGFFLSILVWLGAIPDDVEGYTRDNLAAAIQDFLICLEMPAFAVAHWYAFSWHDFANNNILSARMPLNYALK
DAFGARDLIQDSKDTFRGSKYGYRAFDSGDKVMAHEESRSRLARLEEGMRYERGGKGKYWIPKPEEINAASPLLG
SQGEPSSSRPDQINENQHGTFDEPELDGTDEGLFSAARLLEFGDWNYPVITASEPLSSRYRPSRENLGLGSPGWT
VSSSASVADPSGRVPNADEIASAANPPQVVPIKKKKKKKVVKHAKPDPSTLGLDREAATSSAADQSHADESEAPQ
ATRPAERAEEQAENEESRCNMPDGDEFRNVWGRDS*
Coding >Ophcf2|03960
ATGATGGCCTCAGGAGGAACCGGCCAGAAGTTCACCTACGCCACGACGGTGGTGGCAGGGGTCGCCTCTCTGGCA
GCGACTCTGCTCTCAGTCCTATCCATATGGCTTCAGGCAAAGAACTACCGAAAGCCCCTCCTCCAGCGCTATGTC
ATCCGAATCCTCGTCATGGTGCCCATCTACTCCATTGCTTCGTGGGCTAGCATGGTGTCTTCTACCACAGCTGCC
TTTCTCGATCCTATTCGAGACATTTACGAGGCTTTCACCATCTACACCTTCTTCCAGCTTCTCATCAACTACCTG
GGCGGGGAGCGGGCCTTGATAATAATGACGCACGGTCGTGCCCCCGTCCAGCATCTGTGGCCCTTGAACCATGTG
CTTCGTCCGGTCGACATCTCGGATCCGCATAGCTTTCTGTCTATCAAGCGTGGCATCTTGCAATATGCATGGCTC
AAGCCCTTACTTTCCCTTGCGACCATCATCATGAAGGCCACGGGCACGTATCAGGAGGGCTACATCGGTGCCGGC
TCTGGGTACTTGTGGAGTGGCATCATCTATAACATCAGCGTCACTGTCAGTCTCTACTCGCTGGGCTTATTCTGG
GTGTGCATGCATCATGACCTGCAGCCGTTCCGGCCAGTCCCCAAGTTCCTCTGCATCAAGCTCATCATCTTTGCC
TCGTACTGGCAAGGCTTCTTCTTGTCAATCCTCGTCTGGCTCGGGGCCATCCCCGACGATGTGGAAGGATACACA
CGCGACAACCTCGCCGCTGCCATACAGGATTTCTTGATCTGCCTCGAGATGCCGGCCTTTGCCGTGGCGCATTGG
TATGCCTTCTCGTGGCACGACTTTGCCAACAACAACATCCTCTCTGCGCGGATGCCGCTCAACTACGCCCTGAAG
GACGCCTTTGGAGCCAGGGATCTGATTCAGGACTCCAAAGACACCTTCCGTGGTAGCAAGTATGGCTACAGGGCA
TTCGACTCTGGTGACAAGGTCATGGCTCACGAGGAGTCGAGATCGAGGCTCGCCAGGCTCGAGGAGGGCATGCGC
TACGAAAGAGGAGGCAAAGGTAAGTATTGGATACCAAAGCCGGAAGAAATCAACGCGGCCTCCCCGCTGCTGGGC
TCTCAAGGCGAGCCGAGTTCTTCGCGCCCCGACCAAATCAATGAGAACCAGCACGGCACCTTTGACGAGCCGGAG
CTGGATGGAACGGACGAGGGCTTGTTCAGCGCGGCGCGGCTTCTGGAGTTTGGAGACTGGAACTATCCCGTAATC
ACCGCCAGCGAGCCGTTGAGCAGTAGATATCGGCCATCGAGGGAGAATTTGGGACTTGGTTCCCCCGGATGGACA
GTCTCCTCTTCAGCATCGGTTGCCGACCCGTCAGGCAGAGTGCCGAACGCGGACGAGATCGCGTCTGCCGCCAAT
CCACCGCAGGTTGTTCCAATCAAGAAGAAGAAAAAGAAGAAGGTGGTGAAACACGCCAAGCCTGACCCGTCCACA
TTGGGTCTCGATCGTGAAGCCGCAACTTCTTCGGCAGCTGACCAAAGCCATGCGGACGAATCCGAGGCACCACAA
GCAACACGACCGGCCGAGAGAGCAGAAGAGCAGGCCGAGAACGAAGAGTCTCGATGCAACATGCCAGATGGCGAC
GAGTTCCGCAATGTCTGGGGTAGAGATTCGTGA
Transcript >Ophcf2|03960
ATGATGGCCTCAGGAGGAACCGGCCAGAAGTTCACCTACGCCACGACGGTGGTGGCAGGGGTCGCCTCTCTGGCA
GCGACTCTGCTCTCAGTCCTATCCATATGGCTTCAGGCAAAGAACTACCGAAAGCCCCTCCTCCAGCGCTATGTC
ATCCGAATCCTCGTCATGGTGCCCATCTACTCCATTGCTTCGTGGGCTAGCATGGTGTCTTCTACCACAGCTGCC
TTTCTCGATCCTATTCGAGACATTTACGAGGCTTTCACCATCTACACCTTCTTCCAGCTTCTCATCAACTACCTG
GGCGGGGAGCGGGCCTTGATAATAATGACGCACGGTCGTGCCCCCGTCCAGCATCTGTGGCCCTTGAACCATGTG
CTTCGTCCGGTCGACATCTCGGATCCGCATAGCTTTCTGTCTATCAAGCGTGGCATCTTGCAATATGCATGGCTC
AAGCCCTTACTTTCCCTTGCGACCATCATCATGAAGGCCACGGGCACGTATCAGGAGGGCTACATCGGTGCCGGC
TCTGGGTACTTGTGGAGTGGCATCATCTATAACATCAGCGTCACTGTCAGTCTCTACTCGCTGGGCTTATTCTGG
GTGTGCATGCATCATGACCTGCAGCCGTTCCGGCCAGTCCCCAAGTTCCTCTGCATCAAGCTCATCATCTTTGCC
TCGTACTGGCAAGGCTTCTTCTTGTCAATCCTCGTCTGGCTCGGGGCCATCCCCGACGATGTGGAAGGATACACA
CGCGACAACCTCGCCGCTGCCATACAGGATTTCTTGATCTGCCTCGAGATGCCGGCCTTTGCCGTGGCGCATTGG
TATGCCTTCTCGTGGCACGACTTTGCCAACAACAACATCCTCTCTGCGCGGATGCCGCTCAACTACGCCCTGAAG
GACGCCTTTGGAGCCAGGGATCTGATTCAGGACTCCAAAGACACCTTCCGTGGTAGCAAGTATGGCTACAGGGCA
TTCGACTCTGGTGACAAGGTCATGGCTCACGAGGAGTCGAGATCGAGGCTCGCCAGGCTCGAGGAGGGCATGCGC
TACGAAAGAGGAGGCAAAGGTAAGTATTGGATACCAAAGCCGGAAGAAATCAACGCGGCCTCCCCGCTGCTGGGC
TCTCAAGGCGAGCCGAGTTCTTCGCGCCCCGACCAAATCAATGAGAACCAGCACGGCACCTTTGACGAGCCGGAG
CTGGATGGAACGGACGAGGGCTTGTTCAGCGCGGCGCGGCTTCTGGAGTTTGGAGACTGGAACTATCCCGTAATC
ACCGCCAGCGAGCCGTTGAGCAGTAGATATCGGCCATCGAGGGAGAATTTGGGACTTGGTTCCCCCGGATGGACA
GTCTCCTCTTCAGCATCGGTTGCCGACCCGTCAGGCAGAGTGCCGAACGCGGACGAGATCGCGTCTGCCGCCAAT
CCACCGCAGGTTGTTCCAATCAAGAAGAAGAAAAAGAAGAAGGTGGTGAAACACGCCAAGCCTGACCCGTCCACA
TTGGGTCTCGATCGTGAAGCCGCAACTTCTTCGGCAGCTGACCAAAGCCATGCGGACGAATCCGAGGCACCACAA
GCAACACGACCGGCCGAGAGAGCAGAAGAGCAGGCCGAGAACGAAGAGTCTCGATGCAACATGCCAGATGGCGAC
GAGTTCCGCAATGTCTGGGGTAGAGATTCGTGA
Gene >Ophcf2|03960
ATGATGGCCTCAGGAGGAACCGGCCAGAAGTTCACCTACGCCACGACGGTGGTGGCAGGGGTCGCCTCTCTGGCA
GCGACTCTGCTCTCAGTCCTGTACGTCGGCTAACCTCCCCGACCTCTGAGGCACAGAAGGCATATGCTGATACGT
CCCGTGAAATAGATCCATATGGCTTCAGGCAAAGAACTACCGAAAGCCCCTCCTCCAGCGCTATGTCATCCGAAT
CCTCGTCATGGTGCCCATCTACTCCATTGCTTCGTGGGCTAGCATGGTGTCTTCTACCACAGCTGCCTTTCTCGA
TCCTATTCGAGACATTTACGAGGCTTTCACCATCTACACCTTCTTCCAGCTTCTCATCAACTACCTGGGCGGGGA
GCGGGCCTTGATAATAATGACGCACGGTCGTGCCCCCGTCCAGCATCTGTGGCCCTTGAACCATGTGCTTCGTCC
GGTCGACATCTCGGATCCGCATAGCTTTCTGTCTATCAAGCGTGGCATCTTGCAATATGCATGGCTCAAGCCCTT
ACTTTCCCTTGCGACCATCATCATGAAGGCCACGGGCACGTATCAGGAGGGCTACATCGGTGCCGGCTCTGGGTA
CTTGTGGAGTGGCATCATCTATAACATCAGCGTCACTGTCAGTCTCTACTCGCTGGGCTTATTCTGGGTGTGCAT
GCATCATGACCTGCAGCCGTTCCGGCCAGTCCCCAAGTTCCTCTGCATCAAGCTCATCATCTTTGCCTCGTACTG
GCAAGGCTTCTTCTTGTCAATCCTCGTCTGGCTCGGGGCCATCCCCGACGATGTGGAAGGATACACACGCGACAA
CCTCGCCGCTGCCATACAGGATTTCTTGATCTGCCTCGAGATGCCGGCCTTTGCCGTGGCGCATTGGTATGCCTT
CTCGTGGCACGACTTTGCCAACAACAACATCCTCTCTGCGCGGATGCCGCTCAACTACGCCCTGAAGGACGCCTT
TGGAGCCAGGGATCTGATTCAGGACTCCAAAGACACCTTCCGTGGTAGCAAGTATGGCTACAGGGCATTCGACTC
TGGTGACAAGGTCATGGCTCACGAGGAGTCGAGATCGAGGCTCGCCAGGCTCGAGGAGGGCATGCGCTACGAAAG
AGGAGGCAAAGGTAAGTATTGGATACCAAAGCCGGAAGAAATCAACGCGGCCTCCCCGCTGCTGGGCTCTCAAGG
CGAGCCGAGTTCTTCGCGCCCCGACCAAATCAATGAGAACCAGCACGGCACCTTTGACGAGCCGGAGCTGGATGG
AACGGACGAGGGCTTGTTCAGCGCGGCGCGGCTTCTGGAGTTTGGAGACTGGAACGTGAGTGCCGGCCCCTCTCG
ACCTCGTTTCAAACTGACGATTCGGCACTAGTATCCCGTAATCACCGCCAGCGAGCCGTTGAGCAGTAGATATCG
GCCATCGAGGGAGAATTTGGGACTTGGTTCCCCCGGATGGACAGTCTCCTCTTCAGCATCGGTTGCCGACCCGTC
AGGCAGAGTGCCGAACGCGGACGAGATCGCGTCTGCCGCCAATCCACCGCAGGTTGTTCCAATCAAGAAGAAGAA
AAAGAAGAAGGTGGTGAAACACGCCAAGCCTGACCCGTCCACATTGGGTCTCGATCGTGAAGCCGCAACTTCTTC
GGCAGCTGACCAAAGCCATGCGGACGAATCCGAGGCACCACAAGCAACACGACCGGCCGAGAGAGCAGAAGAGCA
GGCCGAGAACGAAGAGTCTCGATGCAACATGCCAGATGGCGACGAGTTCCGCAATGTCTGGGGTAGAGATTCGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail