Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03960
Gene name
Locationscaffold_04:491534..493335
Strand+
Gene length (bp)1801
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03619 Solute_trans_a Organic solute transporter Ostalpha 7.5E-94 16 283

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.0998 0.0736 0.021 0.6236 0.0673 0.039 0.5131 0.5415 0.3518 0.048

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 36 21
2 49 71 22
3 86 108 22
4 147 166 19
5 181 203 22
6 216 238 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2308
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|69
Ophiocordyceps australis map64 (Brazil) OphauB2|5937
Ophiocordyceps camponoti-floridani Ophcf2|03960 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3843
Ophiocordyceps kimflemingae Ophio5|1732
Ophiocordyceps subramaniannii Hirsu2|3090

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03960
MMASGGTGQKFTYATTVVAGVASLAATLLSVLSIWLQAKNYRKPLLQRYVIRILVMVPIYSIASWASMVSSTTAA
FLDPIRDIYEAFTIYTFFQLLINYLGGERALIIMTHGRAPVQHLWPLNHVLRPVDISDPHSFLSIKRGILQYAWL
KPLLSLATIIMKATGTYQEGYIGAGSGYLWSGIIYNISVTVSLYSLGLFWVCMHHDLQPFRPVPKFLCIKLIIFA
SYWQGFFLSILVWLGAIPDDVEGYTRDNLAAAIQDFLICLEMPAFAVAHWYAFSWHDFANNNILSARMPLNYALK
DAFGARDLIQDSKDTFRGSKYGYRAFDSGDKVMAHEESRSRLARLEEGMRYERGGKGKYWIPKPEEINAASPLLG
SQGEPSSSRPDQINENQHGTFDEPELDGTDEGLFSAARLLEFGDWNYPVITASEPLSSRYRPSRENLGLGSPGWT
VSSSASVADPSGRVPNADEIASAANPPQVVPIKKKKKKKVVKHAKPDPSTLGLDREAATSSAADQSHADESEAPQ
ATRPAERAEEQAENEESRCNMPDGDEFRNVWGRDS*
Coding >Ophcf2|03960
ATGATGGCCTCAGGAGGAACCGGCCAGAAGTTCACCTACGCCACGACGGTGGTGGCAGGGGTCGCCTCTCTGGCA
GCGACTCTGCTCTCAGTCCTATCCATATGGCTTCAGGCAAAGAACTACCGAAAGCCCCTCCTCCAGCGCTATGTC
ATCCGAATCCTCGTCATGGTGCCCATCTACTCCATTGCTTCGTGGGCTAGCATGGTGTCTTCTACCACAGCTGCC
TTTCTCGATCCTATTCGAGACATTTACGAGGCTTTCACCATCTACACCTTCTTCCAGCTTCTCATCAACTACCTG
GGCGGGGAGCGGGCCTTGATAATAATGACGCACGGTCGTGCCCCCGTCCAGCATCTGTGGCCCTTGAACCATGTG
CTTCGTCCGGTCGACATCTCGGATCCGCATAGCTTTCTGTCTATCAAGCGTGGCATCTTGCAATATGCATGGCTC
AAGCCCTTACTTTCCCTTGCGACCATCATCATGAAGGCCACGGGCACGTATCAGGAGGGCTACATCGGTGCCGGC
TCTGGGTACTTGTGGAGTGGCATCATCTATAACATCAGCGTCACTGTCAGTCTCTACTCGCTGGGCTTATTCTGG
GTGTGCATGCATCATGACCTGCAGCCGTTCCGGCCAGTCCCCAAGTTCCTCTGCATCAAGCTCATCATCTTTGCC
TCGTACTGGCAAGGCTTCTTCTTGTCAATCCTCGTCTGGCTCGGGGCCATCCCCGACGATGTGGAAGGATACACA
CGCGACAACCTCGCCGCTGCCATACAGGATTTCTTGATCTGCCTCGAGATGCCGGCCTTTGCCGTGGCGCATTGG
TATGCCTTCTCGTGGCACGACTTTGCCAACAACAACATCCTCTCTGCGCGGATGCCGCTCAACTACGCCCTGAAG
GACGCCTTTGGAGCCAGGGATCTGATTCAGGACTCCAAAGACACCTTCCGTGGTAGCAAGTATGGCTACAGGGCA
TTCGACTCTGGTGACAAGGTCATGGCTCACGAGGAGTCGAGATCGAGGCTCGCCAGGCTCGAGGAGGGCATGCGC
TACGAAAGAGGAGGCAAAGGTAAGTATTGGATACCAAAGCCGGAAGAAATCAACGCGGCCTCCCCGCTGCTGGGC
TCTCAAGGCGAGCCGAGTTCTTCGCGCCCCGACCAAATCAATGAGAACCAGCACGGCACCTTTGACGAGCCGGAG
CTGGATGGAACGGACGAGGGCTTGTTCAGCGCGGCGCGGCTTCTGGAGTTTGGAGACTGGAACTATCCCGTAATC
ACCGCCAGCGAGCCGTTGAGCAGTAGATATCGGCCATCGAGGGAGAATTTGGGACTTGGTTCCCCCGGATGGACA
GTCTCCTCTTCAGCATCGGTTGCCGACCCGTCAGGCAGAGTGCCGAACGCGGACGAGATCGCGTCTGCCGCCAAT
CCACCGCAGGTTGTTCCAATCAAGAAGAAGAAAAAGAAGAAGGTGGTGAAACACGCCAAGCCTGACCCGTCCACA
TTGGGTCTCGATCGTGAAGCCGCAACTTCTTCGGCAGCTGACCAAAGCCATGCGGACGAATCCGAGGCACCACAA
GCAACACGACCGGCCGAGAGAGCAGAAGAGCAGGCCGAGAACGAAGAGTCTCGATGCAACATGCCAGATGGCGAC
GAGTTCCGCAATGTCTGGGGTAGAGATTCGTGA
Transcript >Ophcf2|03960
ATGATGGCCTCAGGAGGAACCGGCCAGAAGTTCACCTACGCCACGACGGTGGTGGCAGGGGTCGCCTCTCTGGCA
GCGACTCTGCTCTCAGTCCTATCCATATGGCTTCAGGCAAAGAACTACCGAAAGCCCCTCCTCCAGCGCTATGTC
ATCCGAATCCTCGTCATGGTGCCCATCTACTCCATTGCTTCGTGGGCTAGCATGGTGTCTTCTACCACAGCTGCC
TTTCTCGATCCTATTCGAGACATTTACGAGGCTTTCACCATCTACACCTTCTTCCAGCTTCTCATCAACTACCTG
GGCGGGGAGCGGGCCTTGATAATAATGACGCACGGTCGTGCCCCCGTCCAGCATCTGTGGCCCTTGAACCATGTG
CTTCGTCCGGTCGACATCTCGGATCCGCATAGCTTTCTGTCTATCAAGCGTGGCATCTTGCAATATGCATGGCTC
AAGCCCTTACTTTCCCTTGCGACCATCATCATGAAGGCCACGGGCACGTATCAGGAGGGCTACATCGGTGCCGGC
TCTGGGTACTTGTGGAGTGGCATCATCTATAACATCAGCGTCACTGTCAGTCTCTACTCGCTGGGCTTATTCTGG
GTGTGCATGCATCATGACCTGCAGCCGTTCCGGCCAGTCCCCAAGTTCCTCTGCATCAAGCTCATCATCTTTGCC
TCGTACTGGCAAGGCTTCTTCTTGTCAATCCTCGTCTGGCTCGGGGCCATCCCCGACGATGTGGAAGGATACACA
CGCGACAACCTCGCCGCTGCCATACAGGATTTCTTGATCTGCCTCGAGATGCCGGCCTTTGCCGTGGCGCATTGG
TATGCCTTCTCGTGGCACGACTTTGCCAACAACAACATCCTCTCTGCGCGGATGCCGCTCAACTACGCCCTGAAG
GACGCCTTTGGAGCCAGGGATCTGATTCAGGACTCCAAAGACACCTTCCGTGGTAGCAAGTATGGCTACAGGGCA
TTCGACTCTGGTGACAAGGTCATGGCTCACGAGGAGTCGAGATCGAGGCTCGCCAGGCTCGAGGAGGGCATGCGC
TACGAAAGAGGAGGCAAAGGTAAGTATTGGATACCAAAGCCGGAAGAAATCAACGCGGCCTCCCCGCTGCTGGGC
TCTCAAGGCGAGCCGAGTTCTTCGCGCCCCGACCAAATCAATGAGAACCAGCACGGCACCTTTGACGAGCCGGAG
CTGGATGGAACGGACGAGGGCTTGTTCAGCGCGGCGCGGCTTCTGGAGTTTGGAGACTGGAACTATCCCGTAATC
ACCGCCAGCGAGCCGTTGAGCAGTAGATATCGGCCATCGAGGGAGAATTTGGGACTTGGTTCCCCCGGATGGACA
GTCTCCTCTTCAGCATCGGTTGCCGACCCGTCAGGCAGAGTGCCGAACGCGGACGAGATCGCGTCTGCCGCCAAT
CCACCGCAGGTTGTTCCAATCAAGAAGAAGAAAAAGAAGAAGGTGGTGAAACACGCCAAGCCTGACCCGTCCACA
TTGGGTCTCGATCGTGAAGCCGCAACTTCTTCGGCAGCTGACCAAAGCCATGCGGACGAATCCGAGGCACCACAA
GCAACACGACCGGCCGAGAGAGCAGAAGAGCAGGCCGAGAACGAAGAGTCTCGATGCAACATGCCAGATGGCGAC
GAGTTCCGCAATGTCTGGGGTAGAGATTCGTGA
Gene >Ophcf2|03960
ATGATGGCCTCAGGAGGAACCGGCCAGAAGTTCACCTACGCCACGACGGTGGTGGCAGGGGTCGCCTCTCTGGCA
GCGACTCTGCTCTCAGTCCTGTACGTCGGCTAACCTCCCCGACCTCTGAGGCACAGAAGGCATATGCTGATACGT
CCCGTGAAATAGATCCATATGGCTTCAGGCAAAGAACTACCGAAAGCCCCTCCTCCAGCGCTATGTCATCCGAAT
CCTCGTCATGGTGCCCATCTACTCCATTGCTTCGTGGGCTAGCATGGTGTCTTCTACCACAGCTGCCTTTCTCGA
TCCTATTCGAGACATTTACGAGGCTTTCACCATCTACACCTTCTTCCAGCTTCTCATCAACTACCTGGGCGGGGA
GCGGGCCTTGATAATAATGACGCACGGTCGTGCCCCCGTCCAGCATCTGTGGCCCTTGAACCATGTGCTTCGTCC
GGTCGACATCTCGGATCCGCATAGCTTTCTGTCTATCAAGCGTGGCATCTTGCAATATGCATGGCTCAAGCCCTT
ACTTTCCCTTGCGACCATCATCATGAAGGCCACGGGCACGTATCAGGAGGGCTACATCGGTGCCGGCTCTGGGTA
CTTGTGGAGTGGCATCATCTATAACATCAGCGTCACTGTCAGTCTCTACTCGCTGGGCTTATTCTGGGTGTGCAT
GCATCATGACCTGCAGCCGTTCCGGCCAGTCCCCAAGTTCCTCTGCATCAAGCTCATCATCTTTGCCTCGTACTG
GCAAGGCTTCTTCTTGTCAATCCTCGTCTGGCTCGGGGCCATCCCCGACGATGTGGAAGGATACACACGCGACAA
CCTCGCCGCTGCCATACAGGATTTCTTGATCTGCCTCGAGATGCCGGCCTTTGCCGTGGCGCATTGGTATGCCTT
CTCGTGGCACGACTTTGCCAACAACAACATCCTCTCTGCGCGGATGCCGCTCAACTACGCCCTGAAGGACGCCTT
TGGAGCCAGGGATCTGATTCAGGACTCCAAAGACACCTTCCGTGGTAGCAAGTATGGCTACAGGGCATTCGACTC
TGGTGACAAGGTCATGGCTCACGAGGAGTCGAGATCGAGGCTCGCCAGGCTCGAGGAGGGCATGCGCTACGAAAG
AGGAGGCAAAGGTAAGTATTGGATACCAAAGCCGGAAGAAATCAACGCGGCCTCCCCGCTGCTGGGCTCTCAAGG
CGAGCCGAGTTCTTCGCGCCCCGACCAAATCAATGAGAACCAGCACGGCACCTTTGACGAGCCGGAGCTGGATGG
AACGGACGAGGGCTTGTTCAGCGCGGCGCGGCTTCTGGAGTTTGGAGACTGGAACGTGAGTGCCGGCCCCTCTCG
ACCTCGTTTCAAACTGACGATTCGGCACTAGTATCCCGTAATCACCGCCAGCGAGCCGTTGAGCAGTAGATATCG
GCCATCGAGGGAGAATTTGGGACTTGGTTCCCCCGGATGGACAGTCTCCTCTTCAGCATCGGTTGCCGACCCGTC
AGGCAGAGTGCCGAACGCGGACGAGATCGCGTCTGCCGCCAATCCACCGCAGGTTGTTCCAATCAAGAAGAAGAA
AAAGAAGAAGGTGGTGAAACACGCCAAGCCTGACCCGTCCACATTGGGTCTCGATCGTGAAGCCGCAACTTCTTC
GGCAGCTGACCAAAGCCATGCGGACGAATCCGAGGCACCACAAGCAACACGACCGGCCGAGAGAGCAGAAGAGCA
GGCCGAGAACGAAGAGTCTCGATGCAACATGCCAGATGGCGACGAGTTCCGCAATGTCTGGGGTAGAGATTCGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail