Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03951
Gene name
Locationscaffold_04:461608..462676
Strand-
Gene length (bp)1068
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18457 PUD1_2 Up-Regulated in long-lived daf-2 1.5E-09 10 47

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6642 0.2939 0.4192 0.0437 0.242 0.1015 0.2126 0.2044 0.1163 0.0111

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup36
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2355
Ophiocordyceps australis 1348a (Ghana) OphauG2|7838
Ophiocordyceps australis 1348a (Ghana) OphauG2|6039
Ophiocordyceps australis map64 (Brazil) OphauB2|121
Ophiocordyceps australis map64 (Brazil) OphauB2|6470
Ophiocordyceps australis map64 (Brazil) OphauB2|966
Ophiocordyceps camponoti-floridani Ophcf2|03951 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00019
Ophiocordyceps camponoti-rufipedis Ophun1|2814
Ophiocordyceps camponoti-rufipedis Ophun1|3653
Ophiocordyceps camponoti-rufipedis Ophun1|3154
Ophiocordyceps kimflemingae Ophio5|7975
Ophiocordyceps subramaniannii Hirsu2|7387
Ophiocordyceps subramaniannii Hirsu2|5419
Ophiocordyceps subramaniannii Hirsu2|518
Ophiocordyceps subramaniannii Hirsu2|3897
Ophiocordyceps subramaniannii Hirsu2|3863

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03951
MDLDIPGRGTYKQHILTDKDDGQTTTITINTDGTITLSSPSGDSGTVSDSTPSRGYRAAGPRPFWAIAHRVLTKE
GLLAALHHGANAIEIDVTSHMGEGWFAEHDPIHTRLPIIDQLINGLSIADLLTAVADARRSGHNIKFVWFDIKTA
DLCGAAEGSCNIENLRTTARKLLEPAGVKILWGFQSTDTSARAFQVIRHGLVDNEAIAVDGLGQGLLSLDGMLAP
HQVKPMFSSETSTVPVRQRVWTAGYALPGVRLGSCEYKNRRGESLFICPQIRHVLLSRDYGRVFGWTITKNHVKG
ANVLMEMGVDGLIYGNRMTCYNDGSDTREALGILTDWLDKNGERRYLATLEDEPW*
Coding >Ophcf2|03951
ATGGACTTGGACATACCCGGAAGGGGCACATATAAGCAACACATTCTCACGGATAAAGATGACGGTCAAACAACC
ACCATTACCATCAACACGGACGGTACAATCACGTTGAGTTCTCCATCTGGAGATAGCGGCACTGTCTCCGATTCT
ACACCGTCTCGCGGCTATCGAGCAGCAGGGCCTCGACCGTTCTGGGCTATCGCTCATCGCGTCTTGACCAAGGAA
GGGCTCTTGGCTGCTCTTCATCACGGCGCCAACGCCATAGAGATCGATGTCACCTCTCACATGGGCGAGGGCTGG
TTCGCCGAGCACGATCCCATACATACAAGACTCCCTATCATAGACCAGCTCATCAACGGCTTGTCTATAGCAGAT
CTCCTCACCGCCGTTGCCGACGCTCGCCGATCCGGCCACAATATCAAATTCGTCTGGTTCGATATCAAGACGGCA
GACTTGTGCGGAGCCGCTGAAGGCTCGTGCAACATTGAGAATCTACGTACGACGGCTCGCAAGCTGCTGGAGCCC
GCGGGCGTCAAGATCCTATGGGGCTTTCAGAGTACCGATACGTCAGCTCGGGCTTTCCAGGTGATTCGCCATGGG
TTGGTGGACAACGAGGCCATCGCCGTTGACGGTCTGGGCCAAGGTCTCCTCTCGCTCGACGGTATGTTGGCTCCT
CACCAGGTAAAACCCATGTTCAGCAGCGAGACATCGACTGTTCCTGTACGCCAGCGTGTGTGGACAGCAGGGTAT
GCATTACCCGGCGTGAGGCTCGGCAGTTGCGAGTACAAGAATAGGAGAGGTGAGAGCCTATTCATCTGTCCGCAG
ATCCGCCATGTGCTGCTCTCGCGAGACTATGGGCGAGTGTTTGGGTGGACGATAACAAAGAATCATGTCAAGGGG
GCCAATGTTCTGATGGAGATGGGTGTTGATGGCCTCATTTATGGCAATCGGATGACTTGCTATAATGATGGGAGC
GATACTCGGGAGGCGTTGGGGATTCTCACGGATTGGCTCGACAAGAATGGGGAACGGCGTTATCTTGCGACTTTG
GAGGATGAGCCGTGGTAG
Transcript >Ophcf2|03951
ATGGACTTGGACATACCCGGAAGGGGCACATATAAGCAACACATTCTCACGGATAAAGATGACGGTCAAACAACC
ACCATTACCATCAACACGGACGGTACAATCACGTTGAGTTCTCCATCTGGAGATAGCGGCACTGTCTCCGATTCT
ACACCGTCTCGCGGCTATCGAGCAGCAGGGCCTCGACCGTTCTGGGCTATCGCTCATCGCGTCTTGACCAAGGAA
GGGCTCTTGGCTGCTCTTCATCACGGCGCCAACGCCATAGAGATCGATGTCACCTCTCACATGGGCGAGGGCTGG
TTCGCCGAGCACGATCCCATACATACAAGACTCCCTATCATAGACCAGCTCATCAACGGCTTGTCTATAGCAGAT
CTCCTCACCGCCGTTGCCGACGCTCGCCGATCCGGCCACAATATCAAATTCGTCTGGTTCGATATCAAGACGGCA
GACTTGTGCGGAGCCGCTGAAGGCTCGTGCAACATTGAGAATCTACGTACGACGGCTCGCAAGCTGCTGGAGCCC
GCGGGCGTCAAGATCCTATGGGGCTTTCAGAGTACCGATACGTCAGCTCGGGCTTTCCAGGTGATTCGCCATGGG
TTGGTGGACAACGAGGCCATCGCCGTTGACGGTCTGGGCCAAGGTCTCCTCTCGCTCGACGGTATGTTGGCTCCT
CACCAGGTAAAACCCATGTTCAGCAGCGAGACATCGACTGTTCCTGTACGCCAGCGTGTGTGGACAGCAGGGTAT
GCATTACCCGGCGTGAGGCTCGGCAGTTGCGAGTACAAGAATAGGAGAGGTGAGAGCCTATTCATCTGTCCGCAG
ATCCGCCATGTGCTGCTCTCGCGAGACTATGGGCGAGTGTTTGGGTGGACGATAACAAAGAATCATGTCAAGGGG
GCCAATGTTCTGATGGAGATGGGTGTTGATGGCCTCATTTATGGCAATCGGATGACTTGCTATAATGATGGGAGC
GATACTCGGGAGGCGTTGGGGATTCTCACGGATTGGCTCGACAAGAATGGGGAACGGCGTTATCTTGCGACTTTG
GAGGATGAGCCGTGGTAG
Gene >Ophcf2|03951
ATGGACTTGGACATACCCGGAAGGGGCACATATAAGCAACACATTCTCACGGATAAAGATGACGGTCAAACAACC
ACCATTACCATCAACACGGACGGTACAATCACGTTGAGTTCTCCATCTGGAGATAGCGGCACTGTCTCCGATTCT
ACACCGTCTCGCGGCTATCGAGCAGCAGGGCCTCGACCGTTCTGGGCTATCGCTCATCGCGTCTTGACCAAGGAA
GGGCTCTTGGCTGCTCTTCATCACGGCGCCAACGCCATAGAGATCGATGTCACCTCTCACATGGGCGAGGGCTGG
TTCGCCGAGCACGATCCCATACATACAAGACTCCCTATCATAGACCAGCTCATCAACGGCTTGTCTATAGCAGAT
CTCCTCACCGCCGTTGCCGACGCTCGCCGATCCGGCCACAATATCAAATTCGTCTGGTTCGATATCAAGACGGCA
GACTTGTGCGGAGCCGCTGAAGGCTCGTGCAACATTGAGAATCTACGTACGACGGCTCGCAAGCTGCTGGAGCCC
GCGGGCGTCAAGATCCTATGGGGCTTTCAGAGTACCGATACGTCAGCTCGGGCTTTCCAGGTGATTCGCCATGGG
TTGGTGGACAACGAGGCCATCGCCGTTGACGGTCTGGGCCAAGGTCTCCTCTCGCTCGACGGTATGTTGGCTCCT
CACCAGGTAAAACCCATGTTCAGCAGCGAGACATCGACTGTTCCTGTACGCCAGCGTGTGTGGACAGCAGGGTAT
GCATTACCCGGCGTGAGGCTCGGCAGTTGCGAGTACAAGAATAGGAGAGGTGAGAGCCTATTCATCTGTCCGCAG
ATCCGCCATGTGCTGCTCTCGCGAGACTATGGGCGAGTGTTTGGGTGGACGATAACAAAGAATCATGTCAAGGGG
GCCAATGTTCTGATGGAGATGGGTGTTGATGGCCTCATTTATGGCAATCGGATGACTTGCTATAATGATGGGAGC
GATACTCGGGAGGCGTTGGGGATTCTCACGGATTGGCTCGACAAGAATGGGGAACGGCGTTATCTTGCGACTTTG
GAGGATGAGCCGTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail