Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03945
Gene name
Locationscaffold_04:429044..444282
Strand-
Gene length (bp)15238
Transcript length (bp)13944
Coding sequence length (bp)13944
Protein length (aa) 4648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12774 AAA_6 Hydrolytic ATP binding site of dynein motor region 5.9E-126 1916 2254
PF08385 DHC_N1 Dynein heavy chain, N-terminal region 1 6.9E-120 265 851
PF08393 DHC_N2 Dynein heavy chain, N-terminal region 2 6.1E-119 1371 1773
PF12781 AAA_9 ATP-binding dynein motor region 2.2E-76 3581 3799
PF12780 AAA_8 P-loop containing dynein motor region D4 2.3E-63 2926 3204
PF12775 AAA_7 P-loop containing dynein motor region 1.2E-34 2580 2754
PF12777 MT Microtubule-binding stalk of dynein motor 6.9E-37 3219 3550
PF08611 DUF1774 Fungal protein of unknown function (DUF1774) 3.2E-36 4552 4645
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.7E-12 2242 2376
PF07728 AAA_5 AAA domain (dynein-related subfamily) 9.5E-05 2950 3106
PF18198 AAA_lid_11 Dynein heavy chain AAA lid domain 1.3E-26 4207 4349
PF03028 Dynein_heavy Dynein heavy chain region D6 P-loop domain 1.7E-25 4067 4173
PF17852 Dynein_AAA_lid Dynein heavy chain AAA lid domain 2.5E-12 2445 2568

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0030286 dynein complex Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0008569 minus-end-directed microtubule motor activity Yes
GO:0007018 microtubule-based movement Yes
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0007017 microtubule-based process No
GO:0009987 cellular process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032991 protein-containing complex No
GO:0003824 catalytic activity No
GO:0003777 microtubule motor activity No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:1902494 catalytic complex No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0005875 microtubule associated complex No
GO:0005575 cellular_component No
GO:0032555 purine ribonucleotide binding No
GO:0003774 cytoskeletal motor activity No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0140657 ATP-dependent activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 4381 4403 22
2 4424 4446 22
3 4461 4483 22
4 4490 4509 19
5 4519 4541 22
6 4553 4572 19
7 4603 4625 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 56.99 24.60 89.39
Alive In ants, during behavior modification 85.70 32.78 138.63
Dead In ants, recently dead 81.19 32.68 129.70

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.109181 no
Alive Dead 0.850549 no
Dead Fungus 0.165281 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03945
MEVSSSASPSNGVASPSFPTIEPERVVDHLAAVCEIALGATKLQLEQPGNLLHKSRYAETISRCTRFANDAQSVL
YVQKDVAPSSAPENGAESAAPANFLYTLSTELSASALTVASLVLLKSPQPIDPTRPLTSQIFITNLPGPASLNAA
VGEHGATLSPWEVLHSQVHHALVPYFDANTRSQQAANGARGRTEVDAKTGIPVTKKRLNDLELSLLHLQQNVDIP
DISLTFHSIVQNVVEEAEARHTRPSLDSIPANLLQDSTFLNRLQANVNTWIKSIQGITKMTKDPSPGANQEFSTA
SQEVNFWLSMESALESIEGQLRSEGVLLTLEILKHAKRFQATVSFTADTGLKEAMEKVQKYNQLMRDFPLDELLS
ATSLPKVQEAIAQIFGHLNKKLRICPYPVRRALPLVEAISADLDDVLRRLLPGTELVDLDYHEFQALMRTCDGIF
RVWEDNVKEFTNVAREVTRRRNEKFIPIKIIRKHSELESRIKYVGTFRDNHEQLQRTIVNVLGPGVQAAGGGSDV
ATAATGTTSGVVMEDVGGVDAVMEVKQAWEALQHVDLLDVSDQGKERWVRAENLYNERTTRVENSIIARLRDRLA
TAKTANEMFRVFSKFNALFVRPKIRGAIQEYQNQLMDHVKQAINGLHERFKMQYGHSEAHAMAQLRDLPPVSGAI
IWARQIEFQLDGYMRKVEAVLGPDWHLHAEGHKLREESDLFKRKLNTARIFEAWLADVGRRKISIAGQLFDIARV
RAAGGILELAVNFDPQVITLFKETRNLVWQSYSVPHAVATVSKDAKRVYPYAVSLMESVRTLSQTLRQVSDMGEE
SMLLNGYRNEVYKMIGEGVPLRWESFINSHELFYADQQRQTPRALMPAAGADFGSVAKGTESKHGMFIRSFAAAV
SVLQAKATSLMHIHATVEQALRELGTCPYDASAFQPRLSTIQAAVDQLNLEQYVNLDYWVRGLNQKIQSILLGRL
HAAIQAWISAFEEDTPDDGGRRAKTAGGDDDDDRQHGPAMKRLVLELAMRNQVIYLDPALEHARASWFLLLHDWI
GIVCDLRKIKATRYQMSITTSAAADEPRFSDLPTECAGMLHRVYVSVEKKLQEVGAYVDKWLQFQSLWDLQSEQV
YDMLGDHLPRWLECLQDIRKVRTTFDTQEVSRSFGHITIDYDQVQTKVNAKYDQWQHEILIKFAGRLGNRMRDVH
AEIEKARKHLEGQSSDTSSTAQAVQFITAVQSCKRNVKLWAPEMDLFRQGQSTLVRQRYHFPQDWLHIEQVDSQW
EALKEILDKKSRIMEEQSDAMRANITAQDKLVNERICEIVALWNEEKPVSGTIQPDVASATLASFESRIASLQEE
FLQVVKAKEALDIAASHDSSLEATLEEVRDFQSVWSSLSTIWASLNETRDMLWTAVQPRKVRSKVEDLIKSTKEM
PSRMRQYAAFEHVQGILRGFLKVNAILSDLKSDAIRERHWQKIYKQIRPQRRFSPSSMTLGDVWDLNLVATEAVV
KDIIAQAQGEMALEEFLKQVRETWQNYALEMVNYQSKCRLIRGWDELFAKCSENLNSLQAMKHSPYYKEFEEEAV
AWEDKLNRVHVLFDVWIDVQRQWVYLEGVFTGNADIKHLLPIESGRFQNINSEFLAVMKKANKTPYVLDVLNIPN
AQKSLERLAEMLNKIQKALGEYLEKERVSFPRFYFVGDEDLLEMIGNSNDTLRIAKHFKKMFAGLSGLVMDDESV
ITGFTSKEGEMVKLKKEISVAKTPRINDWLALLEGGMKSTLAELLAEAVDRYAPLFEADDDLLDGALRRFMDEYP
SQVVVLATQAVWTTAVEKSLAGGGGSLPALLEREMQVLGVLADTVLGDLDVILRKKCEQLITECVHQRDAVEKLV
EAGADNAGHYLWLLQMRYVYTPEGDFLGRLHVSMANAKLNYGFEYLGVPDRLVRTPLTDRCFLTLTQALCQRLGG
SPYGPAGTGKTESVKALGLQLGRFTLVFCCDDTFDFQAMGRIFLGICQVGAWGCFDEFNRLEERILSAVSQQIQN
IQLGLRQGAEDDASSQIELVGRQLSVNENTGIFITMNPGYAGRSNLPDNLKKLFRSVAMSKPDKELIAEVMLYSQ
GFSQAKRLSKQTVPFFEQCSGRLSKQAHYDFGLRALKSVLVSSGGLKRARLNDGGEDEGVVEPEIIVQSIRETIA
PKLIKADVELMTGIEADCFPGVPYVPANLGDLEEAIRVLAAERHLVVTDTWMTKILQLYQIQKIHHGVMMVGNSG
SGKSAAWRLLLDALQKVEGVEGVFHVIDSKVMSKEALYGNLDPTTREWTDGLFTSILRKIVDNLRGEDAKRHWIV
FDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPANVRIMFEVETLRYATLATVSRCGMVWFSEDTVTPDMLVAH
YLETLGSVPFEDLDEDSVATGQAPARILAVQARVADLLRSHLCADDFVARVLARAQEYDHIMDFTVARVLTTLFS
LLNKAVRDVIEYNGRHADFPLDADQVEAFVPKKLLLALVWALTGDCPLADRKAFGDDVCAMASFGSPPLDGSGSS
LIDFDVSLPRAEWTPWQDQVPTVEVNTHSITQTDVVIPTLDTVRHEDVLYSWLAEHKPLLLCGPPGSGKTMTLFS
ALRKLPNMEVVGLNFSSATTPGLLIKTFEQYCEYKKTLNGVMLSPTQIGRWLVVFCDEINLPAPDRYGTQRAISF
LRQLVEHNGFWRTSDKSWVTLDRIQFVGACNPPTDAGRTALGARFLRHAPLVMVDYPGELSLNQIYGTFNAAVLK
VVPSLRGYAEALTQAMVRFYLESQRRFTPEIQPHYVYSPRELTRWVRGVYEAIRPLEGLSVEGLMRVWAHEALRL
FQDRLVDESERAWTDEAVRRIASEHFPNVDEEKALGGPILFSNWLSRNYVPVERERLREFVKARLKTFCEEEVDV
PLILFNDVLEHVLRIDRVFRQPQGHLILIGVSGSGKTTLSRFVAWMNGLKVFQIKVHGKYSADDFDEDLRDVLRR
CGCKGEKMCFIMDEANVLDSGFLERMNTLLANAEVPGLFEGDEYAALMTACKEGAQRQNLHLDSPEELYRWFTQQ
IVNNLHVVFTMNPPEGGLSSKAATSPALFNRCVLNWFGDWSDQALFQVGHELTQSVDLDRGAYRAPDSIPAAYRG
LSMPPTHREAVVNSMVHIHYSLGRYNEKLLRQQNKLTFLTPRHFLDFVGQFVRLYNEKREDLEEQQRHLNVGLEK
LRDTVDKVRDLRASLADKKTQLERKDAEANEKLQRMVADQREAEQRRTTSLEIQQALEKQEAEVATRRRVVLEDL
AKAEPAVEEAKASVSNIKRQHLTEVRSMGNPPQGVRLALDAVCTLLGHRIVDWKAVQAVVRRDDFIASIIMFDNG
RQMTRALRAKMRNDFLSNPEFTFEKVNRASKACGPLVQWVAAQVNYSDILDRVGPLKDEVGRLEERALQTKAEAR
AVEANIGALEASIDTYKTEYAALISETQAIKSEMAKVQFKVDRSVRLLDSLSSERTRWEEGSRSFETQIGTLVGD
VLVAAAFVAYSGLYDQTFRKSMMDDWCHQLHLSGILYKSPNPVTDYLSTADERLGWQENTLPADDLCTENAIILK
RFNRYPLIIDPSGRATEFLQRECRDRRLTVTSFLDDGFTKQLESSLRFGNPILIQDAEHLDPILNHVLNKEYQRT
GGRVLMQLGKQEIDFSPSFRLYLSTRDPSAQFAPDICSRATFVNFTVTKGSLRTQSLNDVLKSERPDVDERRTDL
IKLQGEFKVHLRQLEKQLLQALNESRGNILDDDKVIETLETLKTEAADISAKMSSTEGVMAEVEDITRQYGVIAN
SCSAVFAVLDQLHFLNHFYRFSLHYFLDIFRTVLHGNANLEGVADHHGRRDIIVRDLFVNTFKRTALGLLQKDRI
TLAVLLAQASPYAMDRGLMDAVLDGDVRGRDLSSEEGAGEEARREAMTRAGRLPALRGRLGRVSGEEWERFLTDE
LAEDCVPRGLLSGGGGGDGEDDEGAEGAEGAEGAEMRTLSPVDEALLSLLVVKLFRMDRFVPAAERFVGRVFGPE
MLDHVEDLAETVGQVSATVPLALVSSPGFDASYKVDGLVERKGVRCTNIAMGSNEGLASADKAISHAAQTGSWVL
VKNVHLAPTWLQSLEKRMEALSPQDDFRLFLSMESSPRIPVNLIRASRVLMYEQPAGVRANMKDSMSSLSTRAGR
APVERARLYLLICFLHAVAQERLRYAPSLGWKGFWEFNDSDYECSAFIIDTWLERTAGRRSNMAPANMPWEMMRH
LVSETYGGKIDDEEDLKLLRKLVWSLLTPTAYDADHQLMGGLRLPSGTSVQDFMGWIHELPEREPPTYLGLPADA
EKLLLERAIFAMANWQQYNPFSKRESHSAASITTYKILTLLTWILSVVVSIYYTVHAPHDGFTIRHRIWDQNYLY
PSAFTMNHVLADIYWLVLFILQAGYVAHLFSGKSETVYAASSVGSHFVLNNLLHFAFVMLFVRSHFHWAEVMLVI
NFVNLSSLYFRHHAHGRFIHGPAVSGPLAWTFVAIYWNGAIMVPHQHNLVARVFGNIFIWSILGYGAFFIVAYKD
YTMGFALSVLAAAIGVAQFERQVVALQWIFAFVIMAVLFVMTLVVALPAWAGRDLRWRRAEADQERAPLLED*
Coding >Ophcf2|03945
ATGGAGGTATCATCCTCTGCGTCGCCTTCAAATGGCGTCGCGTCGCCGTCTTTCCCGACCATCGAGCCCGAACGC
GTCGTCGATCATCTGGCGGCTGTCTGCGAGATTGCCCTGGGAGCAACGAAGCTTCAGCTCGAACAGCCTGGTAAC
CTGCTGCACAAGAGCCGTTACGCAGAGACGATCTCTCGATGCACACGATTTGCAAACGATGCTCAGAGCGTCCTC
TACGTTCAGAAGGACGTTGCGCCCTCTTCGGCGCCTGAGAATGGTGCCGAGTCTGCTGCCCCCGCCAACTTCCTC
TACACTCTCTCGACTGAGCTGTCTGCATCGGCCTTGACCGTTGCTTCCCTCGTCCTGCTCAAGTCGCCGCAGCCC
ATCGATCCCACCCGTCCGCTCACGTCCCAAATCTTCATCACCAACCTCCCGGGCCCTGCCTCGCTCAACGCCGCT
GTGGGGGAGCACGGCGCAACTCTTTCGCCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTAC
TTCGACGCCAATACCCGCAGTCAGCAGGCGGCGAATGGTGCCAGGGGCCGAACCGAGGTCGACGCCAAGACGGGC
ATCCCCGTCACCAAGAAGAGGCTCAACGACTTGGAGCTCAGCCTGCTTCACCTTCAGCAAAACGTCGACATCCCC
GACATCTCCCTGACCTTTCACTCCATCGTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGGCCTTCG
CTCGACTCTATACCCGCCAACCTGCTGCAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGG
ATCAAGTCCATCCAGGGCATCACCAAGATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCC
AGTCAAGAGGTCAATTTTTGGCTCTCGATGGAGTCCGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGC
GTCCTACTCACACTCGAGATCCTCAAGCACGCCAAGCGTTTTCAGGCCACCGTCAGCTTCACCGCTGACACGGGC
CTCAAGGAGGCCATGGAAAAGGTGCAGAAGTATAACCAGCTGATGCGTGACTTCCCCCTCGACGAGCTCCTCTCC
GCCACGTCGCTGCCCAAGGTCCAGGAGGCTATCGCCCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGC
CCCTACCCCGTCAGGCGGGCCCTTCCCCTGGTCGAGGCCATCTCGGCCGACTTGGACGACGTGCTCCGTCGGCTG
CTGCCGGGCACCGAGCTCGTCGATCTCGATTATCACGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTT
AGGGTGTGGGAGGATAACGTCAAGGAGTTTACCAACGTTGCGCGCGAAGTGACGCGTCGCCGGAACGAAAAGTTC
ATACCCATCAAGATCATCAGGAAGCACTCGGAGCTGGAGTCTCGTATCAAGTACGTCGGCACCTTTCGCGACAAT
CACGAGCAGCTCCAGCGGACCATTGTCAACGTCCTGGGCCCCGGCGTCCAGGCGGCCGGCGGTGGCTCCGACGTC
GCCACGGCCGCCACGGGCACCACAAGCGGCGTCGTCATGGAAGACGTGGGCGGCGTCGACGCCGTCATGGAAGTC
AAGCAGGCCTGGGAAGCGCTGCAGCACGTCGACTTGCTCGACGTTTCCGACCAGGGCAAGGAGCGGTGGGTTCGG
GCTGAGAACCTGTACAACGAGCGGACGACTCGGGTGGAAAACTCGATTATTGCCCGGCTGCGAGACCGGCTCGCG
ACGGCCAAGACGGCCAACGAGATGTTCCGCGTCTTTTCCAAGTTTAACGCGCTCTTTGTGCGGCCCAAGATCAGG
GGCGCCATACAGGAGTATCAGAATCAGTTGATGGACCATGTCAAGCAGGCCATCAACGGCTTGCACGAGCGCTTC
AAGATGCAGTACGGTCACTCTGAGGCTCACGCCATGGCCCAGCTCCGCGACCTGCCCCCCGTCTCGGGAGCCATC
ATCTGGGCGCGCCAGATCGAGTTCCAGCTCGACGGCTACATGAGAAAGGTCGAGGCAGTCCTCGGTCCGGACTGG
CATCTGCACGCCGAGGGACACAAGCTGCGCGAGGAGAGCGACCTGTTCAAGCGCAAGCTCAACACGGCCCGCATC
TTCGAGGCCTGGCTGGCGGACGTCGGCCGGCGCAAGATCTCCATCGCCGGCCAGCTCTTCGACATCGCCCGGGTC
AGGGCCGCCGGCGGTATCCTCGAACTGGCCGTCAACTTTGATCCGCAGGTCATCACGCTCTTCAAGGAGACGAGG
AACCTCGTGTGGCAGTCGTATTCCGTGCCTCACGCCGTCGCCACCGTGTCCAAGGACGCGAAGCGGGTGTATCCC
TACGCCGTCAGCTTGATGGAGAGCGTCAGGACGCTCTCGCAGACGCTGCGGCAGGTTTCCGACATGGGCGAGGAG
TCGATGCTGCTCAACGGCTACCGCAACGAGGTCTACAAGATGATCGGCGAGGGAGTGCCGCTGCGGTGGGAGTCG
TTTATCAACTCGCACGAGCTCTTCTACGCCGACCAGCAGCGTCAGACGCCCCGAGCCCTGATGCCCGCGGCCGGT
GCCGACTTTGGCAGCGTCGCCAAGGGCACGGAGAGCAAGCACGGCATGTTCATCCGGAGCTTCGCCGCCGCCGTC
TCCGTCCTCCAGGCCAAGGCCACGTCTCTGATGCACATTCACGCCACGGTCGAGCAGGCGCTCAGGGAGCTGGGC
ACCTGTCCCTACGATGCCTCGGCCTTCCAGCCGCGCCTCAGCACCATCCAGGCCGCCGTCGACCAGCTGAACCTG
GAGCAGTACGTCAACCTCGACTACTGGGTGCGCGGCCTGAACCAGAAGATCCAGTCCATCCTGCTCGGCCGCCTG
CACGCCGCCATCCAGGCCTGGATCTCCGCCTTCGAGGAAGACACGCCGGACGATGGGGGCCGCCGAGCGAAGACG
GCGGGTGGCGACGACGACGACGACAGGCAGCACGGCCCGGCCATGAAGCGTCTGGTGCTCGAGCTGGCCATGCGG
AACCAGGTCATCTACCTGGACCCTGCCCTGGAGCACGCCCGGGCCAGCTGGTTTCTCCTGCTCCACGACTGGATC
GGCATCGTCTGTGACCTTCGCAAGATCAAGGCGACCAGGTATCAGATGAGCATCACAACCAGCGCCGCCGCCGAC
GAGCCGCGCTTCTCGGACCTGCCGACCGAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAGAAGAAG
CTGCAAGAGGTCGGCGCCTACGTCGACAAGTGGCTCCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAGCAGGTC
TACGACATGCTGGGCGACCACCTCCCGCGATGGCTCGAGTGCCTGCAGGACATCCGCAAGGTTCGAACCACGTTT
GATACGCAAGAGGTCAGCCGCTCGTTCGGGCACATCACCATCGACTACGACCAGGTGCAGACAAAGGTCAACGCA
AAGTACGATCAGTGGCAGCACGAGATCCTCATCAAGTTCGCCGGAAGACTGGGCAACCGCATGCGCGACGTGCAC
GCCGAAATCGAAAAGGCGCGCAAGCATCTCGAGGGCCAGAGCTCTGACACGTCGTCGACGGCGCAGGCGGTTCAG
TTCATCACGGCCGTGCAGAGCTGCAAGCGCAATGTCAAGCTGTGGGCGCCTGAGATGGACCTCTTTCGTCAGGGG
CAGTCGACGCTGGTGCGCCAGCGATACCACTTCCCGCAGGACTGGCTTCACATCGAGCAGGTCGATAGCCAGTGG
GAGGCGCTCAAGGAGATACTCGACAAGAAGTCGCGCATCATGGAGGAGCAGTCGGATGCGATGAGGGCCAACATT
ACGGCGCAGGACAAGCTGGTCAATGAGCGCATCTGCGAGATCGTCGCGCTGTGGAACGAAGAGAAGCCCGTCTCC
GGGACCATCCAGCCCGATGTGGCCTCGGCCACGCTGGCTTCGTTCGAGTCTCGCATCGCCAGTTTGCAGGAAGAG
TTTCTGCAGGTCGTCAAGGCCAAGGAGGCGCTCGACATCGCCGCCTCGCACGACAGCTCCTTGGAGGCGACGCTC
GAGGAGGTCCGGGACTTTCAGTCGGTCTGGTCCAGCCTCTCGACCATATGGGCGAGCCTCAACGAGACGCGCGAC
ATGCTCTGGACGGCCGTACAGCCGCGCAAGGTGCGCAGCAAGGTCGAGGACCTCATCAAGAGCACCAAGGAGATG
CCCAGTCGCATGAGGCAGTACGCCGCTTTCGAACACGTCCAGGGCATCCTCCGAGGCTTCCTCAAGGTCAACGCC
ATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGGCACTGGCAGAAGATATACAAGCAGATCCGGCCGCAG
AGGCGCTTCTCGCCGAGCTCCATGACGCTGGGCGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCCGTTGTC
AAGGACATCATCGCCCAGGCGCAGGGCGAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACGTGGCAG
AACTACGCGCTCGAGATGGTGAATTACCAGAGCAAGTGTCGCCTCATCCGCGGCTGGGACGAGCTCTTTGCCAAG
TGCAGCGAGAACCTCAACTCGCTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAGGAGGAGGCCGTG
GCGTGGGAGGACAAGCTCAACCGGGTCCACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGCCAATGGGTCTAC
CTCGAGGGCGTATTCACCGGCAATGCCGACATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTCCAGAACATC
AACAGCGAGTTCCTGGCCGTCATGAAGAAGGCCAACAAGACGCCCTACGTGCTGGACGTCCTCAACATCCCCAAC
GCCCAGAAGTCGCTGGAGCGCTTGGCCGAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTGGAGAAG
GAGAGGGTCTCGTTTCCGCGCTTCTACTTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGTAACAGCAACGAC
ACGCTGCGCATCGCCAAGCACTTTAAGAAGATGTTCGCCGGCCTTTCGGGTCTGGTCATGGACGACGAGTCGGTC
ATCACGGGCTTCACCTCCAAGGAAGGGGAGATGGTCAAGCTGAAGAAGGAGATATCCGTGGCCAAGACGCCGAGG
ATCAACGACTGGCTGGCGCTGCTCGAGGGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCCGTGGAT
CGGTACGCGCCCCTGTTCGAGGCCGACGACGACCTGTTGGACGGCGCGCTGAGGCGCTTCATGGACGAGTACCCG
AGTCAGGTGGTGGTTCTGGCCACGCAGGCGGTGTGGACGACGGCGGTCGAGAAGTCGTTGGCCGGAGGCGGCGGT
TCGCTGCCGGCGCTGCTGGAGCGCGAGATGCAGGTCCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTCGAC
GTCATCCTGCGCAAGAAGTGCGAGCAGCTCATCACCGAGTGCGTCCATCAGCGGGACGCCGTCGAGAAGCTCGTC
GAGGCCGGAGCCGACAATGCCGGCCATTACCTGTGGCTGCTCCAGATGCGTTACGTCTACACGCCCGAGGGGGAC
TTCCTCGGCCGGCTGCACGTCAGCATGGCCAATGCCAAGCTCAACTACGGCTTCGAGTACCTGGGCGTCCCGGAC
CGTCTCGTGCGGACGCCCCTGACGGACCGGTGCTTCCTCACCTTGACGCAGGCTCTGTGCCAGCGTCTGGGGGGT
TCGCCGTACGGCCCGGCCGGCACGGGCAAGACGGAGTCGGTCAAGGCTCTCGGCCTTCAGCTCGGCCGCTTCACG
CTCGTCTTCTGCTGCGACGACACGTTCGACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATATGCCAGGTCGGC
GCCTGGGGATGCTTCGACGAGTTCAACCGGCTCGAGGAGAGGATCCTGTCGGCCGTGTCGCAGCAGATTCAGAAT
ATCCAGCTCGGCCTCAGGCAGGGTGCCGAGGACGACGCGTCGTCGCAGATCGAGCTGGTCGGCCGCCAGCTGAGC
GTCAATGAGAACACGGGCATCTTCATCACCATGAACCCGGGCTACGCTGGCCGTTCCAACCTGCCGGACAACCTC
AAGAAGCTCTTTCGCAGCGTGGCCATGTCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCCCAA
GGCTTCAGCCAGGCCAAGCGGCTGTCCAAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCGGGCCGGCTCTCGAAG
CAGGCTCACTACGACTTTGGTCTCCGTGCCCTCAAGAGCGTCCTCGTCAGCTCGGGAGGGCTCAAGCGCGCCCGT
CTCAACGACGGCGGCGAGGACGAGGGCGTGGTGGAGCCGGAAATCATCGTGCAGAGCATCCGCGAGACCATCGCG
CCCAAGCTGATCAAGGCCGACGTGGAGCTCATGACGGGCATCGAAGCCGACTGCTTCCCCGGCGTTCCGTACGTG
CCGGCCAACCTCGGGGACCTGGAGGAGGCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACGGACACG
TGGATGACCAAGATCCTCCAGCTGTACCAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAACTCGGGC
AGCGGCAAGTCGGCCGCCTGGAGGTTGCTGCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTCTTCCAC
GTCATCGACTCCAAGGTCATGTCCAAGGAGGCCCTCTACGGCAACCTGGATCCGACGACGCGCGAGTGGACCGAC
GGCCTGTTCACGAGCATCCTGCGCAAGATTGTGGATAACCTCAGGGGCGAGGACGCCAAGAGGCATTGGATCGTC
TTCGACGGCGACGTCGATCCGGAATGGGTCGAGAACCTCAACAGCGTGCTCGACGACAACAAGCTGCTGACGCTG
CCCAACGGCGAGCGGCTCAGCCTCCCGGCCAACGTCCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCGACG
CTGGCGACGGTCAGTCGCTGCGGCATGGTCTGGTTCAGCGAAGACACGGTGACGCCGGACATGCTGGTGGCGCAC
TATCTCGAGACGCTGGGCAGCGTCCCCTTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGCCAGGCGCCGGCG
CGGATCCTGGCCGTTCAGGCCCGGGTGGCCGACCTGCTGCGGTCGCATCTCTGTGCCGACGACTTCGTGGCCCGG
GTGCTGGCGAGGGCTCAGGAGTACGACCACATCATGGACTTTACCGTCGCCCGCGTCCTCACCACGCTCTTCTCG
CTCCTCAACAAGGCGGTGAGGGACGTGATCGAGTACAATGGCCGGCACGCAGACTTTCCCCTGGACGCGGACCAA
GTCGAGGCCTTTGTGCCCAAGAAGCTGCTGCTGGCGCTGGTGTGGGCTCTGACGGGCGACTGTCCGCTGGCTGAC
CGCAAGGCCTTCGGCGACGACGTCTGTGCCATGGCCAGCTTCGGGTCTCCGCCCCTGGACGGCAGCGGCAGCTCG
CTCATCGATTTCGACGTCAGCCTGCCCAGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCTACCGTCGAGGTC
AACACGCACTCGATCACGCAGACGGACGTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGACGTGCTCTAC
TCGTGGCTGGCAGAGCACAAGCCCTTGCTGCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTCTTCAGT
GCCCTCCGCAAGCTGCCCAACATGGAGGTGGTCGGCCTCAACTTCTCCAGCGCGACGACGCCGGGCCTCCTCATC
AAGACGTTTGAGCAGTATTGCGAGTACAAGAAGACGCTCAACGGCGTGATGCTCTCGCCCACGCAGATCGGTCGT
TGGCTCGTCGTCTTTTGTGACGAGATCAACCTGCCGGCTCCGGACAGGTACGGCACGCAGCGGGCCATCTCGTTC
CTGAGGCAGCTGGTGGAGCACAACGGCTTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGGATCCAG
TTCGTCGGCGCCTGCAACCCGCCCACGGACGCGGGCCGGACGGCGCTCGGGGCTCGCTTCCTCCGGCACGCGCCG
CTCGTCATGGTCGACTACCCGGGCGAGCTCTCGCTCAACCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAG
GTGGTGCCGTCGCTGCGCGGGTACGCCGAGGCGCTGACGCAGGCCATGGTGCGCTTCTACCTCGAGTCGCAGCGG
CGGTTCACGCCCGAGATACAGCCGCATTACGTCTACAGCCCGCGCGAGCTCACGCGCTGGGTCAGGGGCGTGTAC
GAGGCCATCCGGCCGCTCGAGGGGCTGTCGGTCGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTGCGCCTC
TTCCAGGACCGGCTGGTGGACGAGTCGGAGAGGGCGTGGACGGACGAGGCCGTCCGACGCATTGCCTCGGAGCAC
TTCCCCAACGTCGACGAGGAGAAGGCGCTGGGCGGGCCCATCCTGTTCTCCAACTGGTTGTCGCGCAACTACGTG
CCGGTCGAGAGGGAGCGGTTGCGCGAGTTCGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTGGACGTG
CCGCTGATCCTGTTCAACGACGTGCTGGAGCATGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGTCAT
TTGATACTGATTGGCGTCAGCGGCAGCGGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGCCTCAAG
GTGTTTCAGATCAAGGTGCACGGCAAGTACTCGGCCGACGACTTCGACGAGGACCTGCGGGACGTGCTGCGGAGG
TGCGGCTGCAAGGGTGAGAAGATGTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTGGAGCGC
ATGAACACGCTGCTGGCCAACGCCGAGGTCCCCGGCCTGTTCGAGGGCGACGAGTACGCGGCCCTGATGACGGCC
TGCAAGGAGGGGGCGCAGCGGCAGAACCTGCACCTCGACTCTCCCGAAGAGCTGTATCGCTGGTTCACGCAGCAG
ATCGTCAACAACCTGCACGTCGTCTTCACCATGAACCCGCCCGAGGGGGGGCTGTCGTCCAAGGCGGCGACGAGC
CCGGCGCTGTTCAACCGTTGCGTGCTCAACTGGTTCGGCGACTGGTCGGACCAGGCGCTCTTCCAGGTCGGTCAC
GAGCTGACGCAGTCGGTCGACCTGGACCGCGGCGCATACCGGGCTCCCGACTCGATACCGGCGGCGTATCGGGGC
CTGTCGATGCCGCCGACGCACCGCGAGGCCGTGGTCAACTCGATGGTCCACATCCACTACTCGCTGGGGCGGTAC
AACGAGAAGCTGCTCCGGCAGCAGAACAAGCTGACCTTCCTGACGCCGCGGCACTTCCTCGACTTCGTGGGCCAG
TTCGTGCGCTTGTACAACGAGAAGCGGGAGGACCTGGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTCGAGAAG
CTGCGCGACACGGTGGACAAGGTGCGCGATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAGCGCAAG
GACGCCGAGGCCAACGAGAAGCTGCAGCGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGCGGACGACGTCG
CTGGAGATTCAGCAGGCGTTGGAGAAGCAGGAGGCCGAGGTGGCGACGCGGCGACGGGTCGTGCTGGAGGACCTG
GCCAAGGCCGAACCGGCCGTCGAGGAGGCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACGGAGGTG
CGGTCGATGGGCAACCCGCCTCAGGGGGTGAGGCTGGCGCTCGATGCCGTCTGCACGCTGCTGGGCCACCGGATC
GTGGACTGGAAGGCGGTGCAGGCCGTGGTCCGGCGAGACGACTTCATCGCCAGCATCATCATGTTCGACAACGGG
CGGCAGATGACGAGGGCTCTGCGGGCCAAGATGCGCAACGACTTCCTCTCCAACCCGGAGTTTACGTTCGAAAAG
GTCAACAGGGCGTCCAAGGCGTGCGGTCCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCGGACATACTG
GACCGCGTCGGGCCGCTCAAGGACGAGGTCGGCCGGCTGGAGGAACGGGCGCTGCAGACGAAGGCCGAGGCTCGG
GCGGTCGAGGCCAACATCGGCGCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTCATCAGC
GAGACGCAGGCCATCAAGTCGGAGATGGCAAAGGTCCAGTTCAAGGTGGACCGCAGCGTCCGGCTGCTCGACAGC
CTGTCTTCGGAGAGGACCCGATGGGAGGAGGGCAGCCGGTCGTTCGAGACGCAGATCGGCACGCTGGTGGGCGAC
GTGCTGGTGGCGGCCGCCTTCGTGGCCTACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCCATGATGGACGAC
TGGTGCCATCAGCTTCACCTCTCGGGCATCCTGTACAAGTCGCCCAACCCGGTGACGGACTATCTGTCGACGGCG
GACGAGCGGCTGGGCTGGCAGGAGAACACGCTGCCGGCGGACGACCTGTGCACGGAGAACGCCATCATCCTGAAG
CGCTTCAACCGCTATCCCCTCATCATCGATCCGTCGGGGAGGGCGACCGAGTTCCTGCAGCGCGAGTGTCGCGAC
AGGCGGCTGACGGTGACGAGCTTCCTCGACGACGGCTTCACCAAGCAGCTCGAGAGCTCCCTGCGCTTCGGCAAC
CCGATCCTGATACAGGACGCCGAACACCTGGACCCCATCCTCAACCACGTGCTCAACAAGGAGTATCAGCGCACG
GGGGGCCGGGTGCTGATGCAGCTGGGCAAGCAGGAGATTGACTTCTCGCCCTCGTTCCGCCTCTACCTTTCGACG
CGCGATCCGTCGGCCCAGTTCGCGCCCGACATCTGCAGCAGGGCTACCTTTGTCAACTTCACCGTCACAAAGGGC
AGCTTGCGGACGCAGTCGCTCAACGACGTGCTCAAGTCGGAGCGGCCCGACGTCGACGAGCGCCGGACCGACCTC
ATCAAGCTGCAGGGAGAGTTCAAGGTTCACCTACGCCAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAACGAGTCG
CGCGGCAACATCCTCGACGACGACAAGGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCCGCCGACATCTCG
GCCAAGATGAGCAGCACCGAGGGCGTCATGGCCGAGGTGGAGGACATCACGAGACAGTACGGCGTCATCGCCAAC
TCGTGCAGCGCCGTCTTCGCCGTGCTGGATCAGCTGCACTTTCTCAACCACTTCTACCGCTTCTCGCTGCATTAC
TTCCTCGACATCTTCCGCACGGTCCTGCACGGCAACGCCAATCTCGAGGGCGTGGCCGATCACCACGGCCGTCGC
GACATCATCGTCCGCGACCTGTTCGTCAACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGACCGCATA
ACGCTGGCGGTGCTGCTGGCTCAGGCGTCGCCCTACGCCATGGACAGGGGGCTGATGGACGCGGTGCTCGACGGC
GACGTCCGGGGTCGCGACCTGTCGTCGGAGGAGGGGGCGGGCGAGGAGGCGCGTCGAGAGGCCATGACCCGGGCC
GGACGGCTGCCCGCGCTACGGGGCCGGCTGGGGAGGGTGTCGGGCGAGGAGTGGGAGCGCTTCCTCACGGACGAG
CTGGCCGAGGACTGCGTCCCGCGGGGGCTGTTGTCGGGCGGCGGCGGCGGTGACGGAGAAGATGATGAGGGGGCC
GAGGGGGCCGAGGGGGCCGAGGGTGCCGAGATGCGGACGCTGAGCCCCGTCGACGAGGCTCTCCTCTCGCTGCTC
GTCGTCAAGCTGTTCCGGATGGACCGGTTCGTGCCGGCGGCCGAGCGGTTCGTGGGCCGCGTCTTCGGGCCCGAG
ATGCTGGACCACGTCGAGGACCTCGCCGAGACGGTCGGCCAGGTCTCGGCCACGGTCCCCCTCGCGCTCGTGTCC
AGCCCGGGCTTCGACGCCAGCTACAAGGTCGACGGGCTGGTGGAGCGAAAGGGGGTGCGGTGCACCAACATCGCC
ATGGGCTCCAACGAGGGCCTGGCCAGCGCGGACAAGGCCATCAGTCACGCCGCCCAGACGGGATCGTGGGTCCTG
GTCAAGAACGTCCACCTGGCGCCCACCTGGCTGCAGAGCCTGGAGAAGCGGATGGAGGCGCTGAGCCCGCAGGAC
GACTTCCGGCTGTTCCTGTCGATGGAGTCGAGTCCGCGGATCCCGGTGAACCTGATCCGGGCGTCGAGGGTGCTC
ATGTACGAGCAGCCGGCCGGGGTGAGGGCCAACATGAAGGACTCGATGTCTTCGCTCTCGACGAGGGCGGGGAGG
GCGCCGGTCGAGAGGGCGAGGCTTTACCTGTTGATCTGCTTCCTGCACGCCGTCGCGCAGGAGAGGTTGCGGTAC
GCGCCGAGTCTGGGGTGGAAGGGGTTCTGGGAGTTTAACGACAGCGATTATGAGTGCTCGGCTTTCATCATCGAT
ACCTGGCTGGAGAGGACGGCCGGACGGCGAAGCAACATGGCCCCGGCCAACATGCCGTGGGAGATGATGCGGCAT
CTCGTCAGCGAGACGTACGGCGGCAAGATCGACGACGAGGAAGACCTGAAGCTGCTGCGGAAGCTGGTATGGTCT
CTCCTGACGCCGACGGCCTACGACGCGGACCACCAGCTCATGGGCGGGCTCCGGTTGCCGTCGGGGACGAGCGTG
CAGGACTTTATGGGCTGGATCCACGAGTTGCCGGAGAGGGAGCCGCCGACGTATCTGGGGTTGCCGGCGGACGCG
GAGAAGTTGTTGCTGGAGAGAGCGATATTCGCCATGGCTAACTGGCAGCAGTATAACCCCTTCAGCAAGCGCGAA
TCCCATAGCGCGGCCTCCATCACAACCTACAAGATCCTCACCCTCCTAACCTGGATCCTCTCCGTCGTCGTCTCC
ATCTACTACACCGTCCACGCGCCCCACGATGGCTTCACCATCCGTCACCGCATCTGGGACCAGAATTACCTGTAC
CCCAGCGCCTTCACCATGAATCACGTCCTCGCCGACATCTACTGGCTCGTCCTCTTCATCCTTCAGGCCGGTTAC
GTGGCGCACCTCTTCTCCGGCAAGTCCGAGACGGTGTACGCTGCCTCTTCGGTGGGGAGTCACTTCGTGCTGAAC
AACCTGCTGCACTTTGCCTTTGTCATGTTGTTTGTGCGGTCGCATTTTCATTGGGCTGAGGTCATGCTCGTCATC
AACTTTGTCAACCTCAGCTCTCTGTACTTTCGCCATCATGCGCATGGGCGATTCATCCATGGGCCTGCCGTTTCG
GGGCCTTTGGCTTGGACTTTTGTCGCCATTTATTGGAACGGGGCCATCATGGTGCCGCATCAGCATAATCTCGTG
GCCCGCGTGTTTGGCAACATCTTCATCTGGTCCATCCTCGGCTACGGAGCCTTCTTCATCGTTGCTTACAAGGAC
TACACCATGGGCTTCGCGCTCAGCGTCCTGGCTGCGGCCATTGGCGTGGCGCAGTTTGAGAGGCAGGTCGTTGCC
TTGCAGTGGATCTTCGCCTTTGTCATCATGGCGGTTTTGTTCGTCATGACGCTGGTGGTTGCTTTGCCGGCTTGG
GCGGGTAGGGATTTGAGGTGGAGGCGGGCTGAGGCTGATCAGGAGAGGGCGCCTTTGCTGGAGGATTAG
Transcript >Ophcf2|03945
ATGGAGGTATCATCCTCTGCGTCGCCTTCAAATGGCGTCGCGTCGCCGTCTTTCCCGACCATCGAGCCCGAACGC
GTCGTCGATCATCTGGCGGCTGTCTGCGAGATTGCCCTGGGAGCAACGAAGCTTCAGCTCGAACAGCCTGGTAAC
CTGCTGCACAAGAGCCGTTACGCAGAGACGATCTCTCGATGCACACGATTTGCAAACGATGCTCAGAGCGTCCTC
TACGTTCAGAAGGACGTTGCGCCCTCTTCGGCGCCTGAGAATGGTGCCGAGTCTGCTGCCCCCGCCAACTTCCTC
TACACTCTCTCGACTGAGCTGTCTGCATCGGCCTTGACCGTTGCTTCCCTCGTCCTGCTCAAGTCGCCGCAGCCC
ATCGATCCCACCCGTCCGCTCACGTCCCAAATCTTCATCACCAACCTCCCGGGCCCTGCCTCGCTCAACGCCGCT
GTGGGGGAGCACGGCGCAACTCTTTCGCCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTAC
TTCGACGCCAATACCCGCAGTCAGCAGGCGGCGAATGGTGCCAGGGGCCGAACCGAGGTCGACGCCAAGACGGGC
ATCCCCGTCACCAAGAAGAGGCTCAACGACTTGGAGCTCAGCCTGCTTCACCTTCAGCAAAACGTCGACATCCCC
GACATCTCCCTGACCTTTCACTCCATCGTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGGCCTTCG
CTCGACTCTATACCCGCCAACCTGCTGCAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGG
ATCAAGTCCATCCAGGGCATCACCAAGATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCC
AGTCAAGAGGTCAATTTTTGGCTCTCGATGGAGTCCGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGC
GTCCTACTCACACTCGAGATCCTCAAGCACGCCAAGCGTTTTCAGGCCACCGTCAGCTTCACCGCTGACACGGGC
CTCAAGGAGGCCATGGAAAAGGTGCAGAAGTATAACCAGCTGATGCGTGACTTCCCCCTCGACGAGCTCCTCTCC
GCCACGTCGCTGCCCAAGGTCCAGGAGGCTATCGCCCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGC
CCCTACCCCGTCAGGCGGGCCCTTCCCCTGGTCGAGGCCATCTCGGCCGACTTGGACGACGTGCTCCGTCGGCTG
CTGCCGGGCACCGAGCTCGTCGATCTCGATTATCACGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTT
AGGGTGTGGGAGGATAACGTCAAGGAGTTTACCAACGTTGCGCGCGAAGTGACGCGTCGCCGGAACGAAAAGTTC
ATACCCATCAAGATCATCAGGAAGCACTCGGAGCTGGAGTCTCGTATCAAGTACGTCGGCACCTTTCGCGACAAT
CACGAGCAGCTCCAGCGGACCATTGTCAACGTCCTGGGCCCCGGCGTCCAGGCGGCCGGCGGTGGCTCCGACGTC
GCCACGGCCGCCACGGGCACCACAAGCGGCGTCGTCATGGAAGACGTGGGCGGCGTCGACGCCGTCATGGAAGTC
AAGCAGGCCTGGGAAGCGCTGCAGCACGTCGACTTGCTCGACGTTTCCGACCAGGGCAAGGAGCGGTGGGTTCGG
GCTGAGAACCTGTACAACGAGCGGACGACTCGGGTGGAAAACTCGATTATTGCCCGGCTGCGAGACCGGCTCGCG
ACGGCCAAGACGGCCAACGAGATGTTCCGCGTCTTTTCCAAGTTTAACGCGCTCTTTGTGCGGCCCAAGATCAGG
GGCGCCATACAGGAGTATCAGAATCAGTTGATGGACCATGTCAAGCAGGCCATCAACGGCTTGCACGAGCGCTTC
AAGATGCAGTACGGTCACTCTGAGGCTCACGCCATGGCCCAGCTCCGCGACCTGCCCCCCGTCTCGGGAGCCATC
ATCTGGGCGCGCCAGATCGAGTTCCAGCTCGACGGCTACATGAGAAAGGTCGAGGCAGTCCTCGGTCCGGACTGG
CATCTGCACGCCGAGGGACACAAGCTGCGCGAGGAGAGCGACCTGTTCAAGCGCAAGCTCAACACGGCCCGCATC
TTCGAGGCCTGGCTGGCGGACGTCGGCCGGCGCAAGATCTCCATCGCCGGCCAGCTCTTCGACATCGCCCGGGTC
AGGGCCGCCGGCGGTATCCTCGAACTGGCCGTCAACTTTGATCCGCAGGTCATCACGCTCTTCAAGGAGACGAGG
AACCTCGTGTGGCAGTCGTATTCCGTGCCTCACGCCGTCGCCACCGTGTCCAAGGACGCGAAGCGGGTGTATCCC
TACGCCGTCAGCTTGATGGAGAGCGTCAGGACGCTCTCGCAGACGCTGCGGCAGGTTTCCGACATGGGCGAGGAG
TCGATGCTGCTCAACGGCTACCGCAACGAGGTCTACAAGATGATCGGCGAGGGAGTGCCGCTGCGGTGGGAGTCG
TTTATCAACTCGCACGAGCTCTTCTACGCCGACCAGCAGCGTCAGACGCCCCGAGCCCTGATGCCCGCGGCCGGT
GCCGACTTTGGCAGCGTCGCCAAGGGCACGGAGAGCAAGCACGGCATGTTCATCCGGAGCTTCGCCGCCGCCGTC
TCCGTCCTCCAGGCCAAGGCCACGTCTCTGATGCACATTCACGCCACGGTCGAGCAGGCGCTCAGGGAGCTGGGC
ACCTGTCCCTACGATGCCTCGGCCTTCCAGCCGCGCCTCAGCACCATCCAGGCCGCCGTCGACCAGCTGAACCTG
GAGCAGTACGTCAACCTCGACTACTGGGTGCGCGGCCTGAACCAGAAGATCCAGTCCATCCTGCTCGGCCGCCTG
CACGCCGCCATCCAGGCCTGGATCTCCGCCTTCGAGGAAGACACGCCGGACGATGGGGGCCGCCGAGCGAAGACG
GCGGGTGGCGACGACGACGACGACAGGCAGCACGGCCCGGCCATGAAGCGTCTGGTGCTCGAGCTGGCCATGCGG
AACCAGGTCATCTACCTGGACCCTGCCCTGGAGCACGCCCGGGCCAGCTGGTTTCTCCTGCTCCACGACTGGATC
GGCATCGTCTGTGACCTTCGCAAGATCAAGGCGACCAGGTATCAGATGAGCATCACAACCAGCGCCGCCGCCGAC
GAGCCGCGCTTCTCGGACCTGCCGACCGAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAGAAGAAG
CTGCAAGAGGTCGGCGCCTACGTCGACAAGTGGCTCCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAGCAGGTC
TACGACATGCTGGGCGACCACCTCCCGCGATGGCTCGAGTGCCTGCAGGACATCCGCAAGGTTCGAACCACGTTT
GATACGCAAGAGGTCAGCCGCTCGTTCGGGCACATCACCATCGACTACGACCAGGTGCAGACAAAGGTCAACGCA
AAGTACGATCAGTGGCAGCACGAGATCCTCATCAAGTTCGCCGGAAGACTGGGCAACCGCATGCGCGACGTGCAC
GCCGAAATCGAAAAGGCGCGCAAGCATCTCGAGGGCCAGAGCTCTGACACGTCGTCGACGGCGCAGGCGGTTCAG
TTCATCACGGCCGTGCAGAGCTGCAAGCGCAATGTCAAGCTGTGGGCGCCTGAGATGGACCTCTTTCGTCAGGGG
CAGTCGACGCTGGTGCGCCAGCGATACCACTTCCCGCAGGACTGGCTTCACATCGAGCAGGTCGATAGCCAGTGG
GAGGCGCTCAAGGAGATACTCGACAAGAAGTCGCGCATCATGGAGGAGCAGTCGGATGCGATGAGGGCCAACATT
ACGGCGCAGGACAAGCTGGTCAATGAGCGCATCTGCGAGATCGTCGCGCTGTGGAACGAAGAGAAGCCCGTCTCC
GGGACCATCCAGCCCGATGTGGCCTCGGCCACGCTGGCTTCGTTCGAGTCTCGCATCGCCAGTTTGCAGGAAGAG
TTTCTGCAGGTCGTCAAGGCCAAGGAGGCGCTCGACATCGCCGCCTCGCACGACAGCTCCTTGGAGGCGACGCTC
GAGGAGGTCCGGGACTTTCAGTCGGTCTGGTCCAGCCTCTCGACCATATGGGCGAGCCTCAACGAGACGCGCGAC
ATGCTCTGGACGGCCGTACAGCCGCGCAAGGTGCGCAGCAAGGTCGAGGACCTCATCAAGAGCACCAAGGAGATG
CCCAGTCGCATGAGGCAGTACGCCGCTTTCGAACACGTCCAGGGCATCCTCCGAGGCTTCCTCAAGGTCAACGCC
ATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGGCACTGGCAGAAGATATACAAGCAGATCCGGCCGCAG
AGGCGCTTCTCGCCGAGCTCCATGACGCTGGGCGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCCGTTGTC
AAGGACATCATCGCCCAGGCGCAGGGCGAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACGTGGCAG
AACTACGCGCTCGAGATGGTGAATTACCAGAGCAAGTGTCGCCTCATCCGCGGCTGGGACGAGCTCTTTGCCAAG
TGCAGCGAGAACCTCAACTCGCTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAGGAGGAGGCCGTG
GCGTGGGAGGACAAGCTCAACCGGGTCCACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGCCAATGGGTCTAC
CTCGAGGGCGTATTCACCGGCAATGCCGACATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTCCAGAACATC
AACAGCGAGTTCCTGGCCGTCATGAAGAAGGCCAACAAGACGCCCTACGTGCTGGACGTCCTCAACATCCCCAAC
GCCCAGAAGTCGCTGGAGCGCTTGGCCGAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTGGAGAAG
GAGAGGGTCTCGTTTCCGCGCTTCTACTTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGTAACAGCAACGAC
ACGCTGCGCATCGCCAAGCACTTTAAGAAGATGTTCGCCGGCCTTTCGGGTCTGGTCATGGACGACGAGTCGGTC
ATCACGGGCTTCACCTCCAAGGAAGGGGAGATGGTCAAGCTGAAGAAGGAGATATCCGTGGCCAAGACGCCGAGG
ATCAACGACTGGCTGGCGCTGCTCGAGGGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCCGTGGAT
CGGTACGCGCCCCTGTTCGAGGCCGACGACGACCTGTTGGACGGCGCGCTGAGGCGCTTCATGGACGAGTACCCG
AGTCAGGTGGTGGTTCTGGCCACGCAGGCGGTGTGGACGACGGCGGTCGAGAAGTCGTTGGCCGGAGGCGGCGGT
TCGCTGCCGGCGCTGCTGGAGCGCGAGATGCAGGTCCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTCGAC
GTCATCCTGCGCAAGAAGTGCGAGCAGCTCATCACCGAGTGCGTCCATCAGCGGGACGCCGTCGAGAAGCTCGTC
GAGGCCGGAGCCGACAATGCCGGCCATTACCTGTGGCTGCTCCAGATGCGTTACGTCTACACGCCCGAGGGGGAC
TTCCTCGGCCGGCTGCACGTCAGCATGGCCAATGCCAAGCTCAACTACGGCTTCGAGTACCTGGGCGTCCCGGAC
CGTCTCGTGCGGACGCCCCTGACGGACCGGTGCTTCCTCACCTTGACGCAGGCTCTGTGCCAGCGTCTGGGGGGT
TCGCCGTACGGCCCGGCCGGCACGGGCAAGACGGAGTCGGTCAAGGCTCTCGGCCTTCAGCTCGGCCGCTTCACG
CTCGTCTTCTGCTGCGACGACACGTTCGACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATATGCCAGGTCGGC
GCCTGGGGATGCTTCGACGAGTTCAACCGGCTCGAGGAGAGGATCCTGTCGGCCGTGTCGCAGCAGATTCAGAAT
ATCCAGCTCGGCCTCAGGCAGGGTGCCGAGGACGACGCGTCGTCGCAGATCGAGCTGGTCGGCCGCCAGCTGAGC
GTCAATGAGAACACGGGCATCTTCATCACCATGAACCCGGGCTACGCTGGCCGTTCCAACCTGCCGGACAACCTC
AAGAAGCTCTTTCGCAGCGTGGCCATGTCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCCCAA
GGCTTCAGCCAGGCCAAGCGGCTGTCCAAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCGGGCCGGCTCTCGAAG
CAGGCTCACTACGACTTTGGTCTCCGTGCCCTCAAGAGCGTCCTCGTCAGCTCGGGAGGGCTCAAGCGCGCCCGT
CTCAACGACGGCGGCGAGGACGAGGGCGTGGTGGAGCCGGAAATCATCGTGCAGAGCATCCGCGAGACCATCGCG
CCCAAGCTGATCAAGGCCGACGTGGAGCTCATGACGGGCATCGAAGCCGACTGCTTCCCCGGCGTTCCGTACGTG
CCGGCCAACCTCGGGGACCTGGAGGAGGCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACGGACACG
TGGATGACCAAGATCCTCCAGCTGTACCAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAACTCGGGC
AGCGGCAAGTCGGCCGCCTGGAGGTTGCTGCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTCTTCCAC
GTCATCGACTCCAAGGTCATGTCCAAGGAGGCCCTCTACGGCAACCTGGATCCGACGACGCGCGAGTGGACCGAC
GGCCTGTTCACGAGCATCCTGCGCAAGATTGTGGATAACCTCAGGGGCGAGGACGCCAAGAGGCATTGGATCGTC
TTCGACGGCGACGTCGATCCGGAATGGGTCGAGAACCTCAACAGCGTGCTCGACGACAACAAGCTGCTGACGCTG
CCCAACGGCGAGCGGCTCAGCCTCCCGGCCAACGTCCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCGACG
CTGGCGACGGTCAGTCGCTGCGGCATGGTCTGGTTCAGCGAAGACACGGTGACGCCGGACATGCTGGTGGCGCAC
TATCTCGAGACGCTGGGCAGCGTCCCCTTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGCCAGGCGCCGGCG
CGGATCCTGGCCGTTCAGGCCCGGGTGGCCGACCTGCTGCGGTCGCATCTCTGTGCCGACGACTTCGTGGCCCGG
GTGCTGGCGAGGGCTCAGGAGTACGACCACATCATGGACTTTACCGTCGCCCGCGTCCTCACCACGCTCTTCTCG
CTCCTCAACAAGGCGGTGAGGGACGTGATCGAGTACAATGGCCGGCACGCAGACTTTCCCCTGGACGCGGACCAA
GTCGAGGCCTTTGTGCCCAAGAAGCTGCTGCTGGCGCTGGTGTGGGCTCTGACGGGCGACTGTCCGCTGGCTGAC
CGCAAGGCCTTCGGCGACGACGTCTGTGCCATGGCCAGCTTCGGGTCTCCGCCCCTGGACGGCAGCGGCAGCTCG
CTCATCGATTTCGACGTCAGCCTGCCCAGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCTACCGTCGAGGTC
AACACGCACTCGATCACGCAGACGGACGTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGACGTGCTCTAC
TCGTGGCTGGCAGAGCACAAGCCCTTGCTGCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTCTTCAGT
GCCCTCCGCAAGCTGCCCAACATGGAGGTGGTCGGCCTCAACTTCTCCAGCGCGACGACGCCGGGCCTCCTCATC
AAGACGTTTGAGCAGTATTGCGAGTACAAGAAGACGCTCAACGGCGTGATGCTCTCGCCCACGCAGATCGGTCGT
TGGCTCGTCGTCTTTTGTGACGAGATCAACCTGCCGGCTCCGGACAGGTACGGCACGCAGCGGGCCATCTCGTTC
CTGAGGCAGCTGGTGGAGCACAACGGCTTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGGATCCAG
TTCGTCGGCGCCTGCAACCCGCCCACGGACGCGGGCCGGACGGCGCTCGGGGCTCGCTTCCTCCGGCACGCGCCG
CTCGTCATGGTCGACTACCCGGGCGAGCTCTCGCTCAACCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAG
GTGGTGCCGTCGCTGCGCGGGTACGCCGAGGCGCTGACGCAGGCCATGGTGCGCTTCTACCTCGAGTCGCAGCGG
CGGTTCACGCCCGAGATACAGCCGCATTACGTCTACAGCCCGCGCGAGCTCACGCGCTGGGTCAGGGGCGTGTAC
GAGGCCATCCGGCCGCTCGAGGGGCTGTCGGTCGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTGCGCCTC
TTCCAGGACCGGCTGGTGGACGAGTCGGAGAGGGCGTGGACGGACGAGGCCGTCCGACGCATTGCCTCGGAGCAC
TTCCCCAACGTCGACGAGGAGAAGGCGCTGGGCGGGCCCATCCTGTTCTCCAACTGGTTGTCGCGCAACTACGTG
CCGGTCGAGAGGGAGCGGTTGCGCGAGTTCGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTGGACGTG
CCGCTGATCCTGTTCAACGACGTGCTGGAGCATGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGTCAT
TTGATACTGATTGGCGTCAGCGGCAGCGGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGCCTCAAG
GTGTTTCAGATCAAGGTGCACGGCAAGTACTCGGCCGACGACTTCGACGAGGACCTGCGGGACGTGCTGCGGAGG
TGCGGCTGCAAGGGTGAGAAGATGTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTGGAGCGC
ATGAACACGCTGCTGGCCAACGCCGAGGTCCCCGGCCTGTTCGAGGGCGACGAGTACGCGGCCCTGATGACGGCC
TGCAAGGAGGGGGCGCAGCGGCAGAACCTGCACCTCGACTCTCCCGAAGAGCTGTATCGCTGGTTCACGCAGCAG
ATCGTCAACAACCTGCACGTCGTCTTCACCATGAACCCGCCCGAGGGGGGGCTGTCGTCCAAGGCGGCGACGAGC
CCGGCGCTGTTCAACCGTTGCGTGCTCAACTGGTTCGGCGACTGGTCGGACCAGGCGCTCTTCCAGGTCGGTCAC
GAGCTGACGCAGTCGGTCGACCTGGACCGCGGCGCATACCGGGCTCCCGACTCGATACCGGCGGCGTATCGGGGC
CTGTCGATGCCGCCGACGCACCGCGAGGCCGTGGTCAACTCGATGGTCCACATCCACTACTCGCTGGGGCGGTAC
AACGAGAAGCTGCTCCGGCAGCAGAACAAGCTGACCTTCCTGACGCCGCGGCACTTCCTCGACTTCGTGGGCCAG
TTCGTGCGCTTGTACAACGAGAAGCGGGAGGACCTGGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTCGAGAAG
CTGCGCGACACGGTGGACAAGGTGCGCGATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAGCGCAAG
GACGCCGAGGCCAACGAGAAGCTGCAGCGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGCGGACGACGTCG
CTGGAGATTCAGCAGGCGTTGGAGAAGCAGGAGGCCGAGGTGGCGACGCGGCGACGGGTCGTGCTGGAGGACCTG
GCCAAGGCCGAACCGGCCGTCGAGGAGGCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACGGAGGTG
CGGTCGATGGGCAACCCGCCTCAGGGGGTGAGGCTGGCGCTCGATGCCGTCTGCACGCTGCTGGGCCACCGGATC
GTGGACTGGAAGGCGGTGCAGGCCGTGGTCCGGCGAGACGACTTCATCGCCAGCATCATCATGTTCGACAACGGG
CGGCAGATGACGAGGGCTCTGCGGGCCAAGATGCGCAACGACTTCCTCTCCAACCCGGAGTTTACGTTCGAAAAG
GTCAACAGGGCGTCCAAGGCGTGCGGTCCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCGGACATACTG
GACCGCGTCGGGCCGCTCAAGGACGAGGTCGGCCGGCTGGAGGAACGGGCGCTGCAGACGAAGGCCGAGGCTCGG
GCGGTCGAGGCCAACATCGGCGCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTCATCAGC
GAGACGCAGGCCATCAAGTCGGAGATGGCAAAGGTCCAGTTCAAGGTGGACCGCAGCGTCCGGCTGCTCGACAGC
CTGTCTTCGGAGAGGACCCGATGGGAGGAGGGCAGCCGGTCGTTCGAGACGCAGATCGGCACGCTGGTGGGCGAC
GTGCTGGTGGCGGCCGCCTTCGTGGCCTACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCCATGATGGACGAC
TGGTGCCATCAGCTTCACCTCTCGGGCATCCTGTACAAGTCGCCCAACCCGGTGACGGACTATCTGTCGACGGCG
GACGAGCGGCTGGGCTGGCAGGAGAACACGCTGCCGGCGGACGACCTGTGCACGGAGAACGCCATCATCCTGAAG
CGCTTCAACCGCTATCCCCTCATCATCGATCCGTCGGGGAGGGCGACCGAGTTCCTGCAGCGCGAGTGTCGCGAC
AGGCGGCTGACGGTGACGAGCTTCCTCGACGACGGCTTCACCAAGCAGCTCGAGAGCTCCCTGCGCTTCGGCAAC
CCGATCCTGATACAGGACGCCGAACACCTGGACCCCATCCTCAACCACGTGCTCAACAAGGAGTATCAGCGCACG
GGGGGCCGGGTGCTGATGCAGCTGGGCAAGCAGGAGATTGACTTCTCGCCCTCGTTCCGCCTCTACCTTTCGACG
CGCGATCCGTCGGCCCAGTTCGCGCCCGACATCTGCAGCAGGGCTACCTTTGTCAACTTCACCGTCACAAAGGGC
AGCTTGCGGACGCAGTCGCTCAACGACGTGCTCAAGTCGGAGCGGCCCGACGTCGACGAGCGCCGGACCGACCTC
ATCAAGCTGCAGGGAGAGTTCAAGGTTCACCTACGCCAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAACGAGTCG
CGCGGCAACATCCTCGACGACGACAAGGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCCGCCGACATCTCG
GCCAAGATGAGCAGCACCGAGGGCGTCATGGCCGAGGTGGAGGACATCACGAGACAGTACGGCGTCATCGCCAAC
TCGTGCAGCGCCGTCTTCGCCGTGCTGGATCAGCTGCACTTTCTCAACCACTTCTACCGCTTCTCGCTGCATTAC
TTCCTCGACATCTTCCGCACGGTCCTGCACGGCAACGCCAATCTCGAGGGCGTGGCCGATCACCACGGCCGTCGC
GACATCATCGTCCGCGACCTGTTCGTCAACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGACCGCATA
ACGCTGGCGGTGCTGCTGGCTCAGGCGTCGCCCTACGCCATGGACAGGGGGCTGATGGACGCGGTGCTCGACGGC
GACGTCCGGGGTCGCGACCTGTCGTCGGAGGAGGGGGCGGGCGAGGAGGCGCGTCGAGAGGCCATGACCCGGGCC
GGACGGCTGCCCGCGCTACGGGGCCGGCTGGGGAGGGTGTCGGGCGAGGAGTGGGAGCGCTTCCTCACGGACGAG
CTGGCCGAGGACTGCGTCCCGCGGGGGCTGTTGTCGGGCGGCGGCGGCGGTGACGGAGAAGATGATGAGGGGGCC
GAGGGGGCCGAGGGGGCCGAGGGTGCCGAGATGCGGACGCTGAGCCCCGTCGACGAGGCTCTCCTCTCGCTGCTC
GTCGTCAAGCTGTTCCGGATGGACCGGTTCGTGCCGGCGGCCGAGCGGTTCGTGGGCCGCGTCTTCGGGCCCGAG
ATGCTGGACCACGTCGAGGACCTCGCCGAGACGGTCGGCCAGGTCTCGGCCACGGTCCCCCTCGCGCTCGTGTCC
AGCCCGGGCTTCGACGCCAGCTACAAGGTCGACGGGCTGGTGGAGCGAAAGGGGGTGCGGTGCACCAACATCGCC
ATGGGCTCCAACGAGGGCCTGGCCAGCGCGGACAAGGCCATCAGTCACGCCGCCCAGACGGGATCGTGGGTCCTG
GTCAAGAACGTCCACCTGGCGCCCACCTGGCTGCAGAGCCTGGAGAAGCGGATGGAGGCGCTGAGCCCGCAGGAC
GACTTCCGGCTGTTCCTGTCGATGGAGTCGAGTCCGCGGATCCCGGTGAACCTGATCCGGGCGTCGAGGGTGCTC
ATGTACGAGCAGCCGGCCGGGGTGAGGGCCAACATGAAGGACTCGATGTCTTCGCTCTCGACGAGGGCGGGGAGG
GCGCCGGTCGAGAGGGCGAGGCTTTACCTGTTGATCTGCTTCCTGCACGCCGTCGCGCAGGAGAGGTTGCGGTAC
GCGCCGAGTCTGGGGTGGAAGGGGTTCTGGGAGTTTAACGACAGCGATTATGAGTGCTCGGCTTTCATCATCGAT
ACCTGGCTGGAGAGGACGGCCGGACGGCGAAGCAACATGGCCCCGGCCAACATGCCGTGGGAGATGATGCGGCAT
CTCGTCAGCGAGACGTACGGCGGCAAGATCGACGACGAGGAAGACCTGAAGCTGCTGCGGAAGCTGGTATGGTCT
CTCCTGACGCCGACGGCCTACGACGCGGACCACCAGCTCATGGGCGGGCTCCGGTTGCCGTCGGGGACGAGCGTG
CAGGACTTTATGGGCTGGATCCACGAGTTGCCGGAGAGGGAGCCGCCGACGTATCTGGGGTTGCCGGCGGACGCG
GAGAAGTTGTTGCTGGAGAGAGCGATATTCGCCATGGCTAACTGGCAGCAGTATAACCCCTTCAGCAAGCGCGAA
TCCCATAGCGCGGCCTCCATCACAACCTACAAGATCCTCACCCTCCTAACCTGGATCCTCTCCGTCGTCGTCTCC
ATCTACTACACCGTCCACGCGCCCCACGATGGCTTCACCATCCGTCACCGCATCTGGGACCAGAATTACCTGTAC
CCCAGCGCCTTCACCATGAATCACGTCCTCGCCGACATCTACTGGCTCGTCCTCTTCATCCTTCAGGCCGGTTAC
GTGGCGCACCTCTTCTCCGGCAAGTCCGAGACGGTGTACGCTGCCTCTTCGGTGGGGAGTCACTTCGTGCTGAAC
AACCTGCTGCACTTTGCCTTTGTCATGTTGTTTGTGCGGTCGCATTTTCATTGGGCTGAGGTCATGCTCGTCATC
AACTTTGTCAACCTCAGCTCTCTGTACTTTCGCCATCATGCGCATGGGCGATTCATCCATGGGCCTGCCGTTTCG
GGGCCTTTGGCTTGGACTTTTGTCGCCATTTATTGGAACGGGGCCATCATGGTGCCGCATCAGCATAATCTCGTG
GCCCGCGTGTTTGGCAACATCTTCATCTGGTCCATCCTCGGCTACGGAGCCTTCTTCATCGTTGCTTACAAGGAC
TACACCATGGGCTTCGCGCTCAGCGTCCTGGCTGCGGCCATTGGCGTGGCGCAGTTTGAGAGGCAGGTCGTTGCC
TTGCAGTGGATCTTCGCCTTTGTCATCATGGCGGTTTTGTTCGTCATGACGCTGGTGGTTGCTTTGCCGGCTTGG
GCGGGTAGGGATTTGAGGTGGAGGCGGGCTGAGGCTGATCAGGAGAGGGCGCCTTTGCTGGAGGATTAG
Gene >Ophcf2|03945
ATGGAGGTATCATCCTCTGCGTCGCCTTCAAATGGCGTCGCGTCGCCGTCTTTCCCGACCATCGAGCCCGAACGC
GTCGTCGATCATCTGGCGGCTGTCTGCGAGATTGCCCTGGGAGCAACGAAGCTTCAGCTCGAACAGCCTGGTAAC
CTGCTGCACAAGAGCCGTTACGCAGAGACGATCTCTCGATGCACACGATTTGCAAACGATGCTCAGAGCGTCCTC
TACGTTCAGAAGGACGTTGCGCCCTCTTCGGCGCCTGAGAATGGTGCCGAGTCTGCTGGTGAGTCCCTCCCTCCC
TCTTCTTAACTCGTCGCTGAACGCCTCTTAGCCCCCGCCAACTTCCTCTACACTCTCTCGACTGAGCTGTCTGCA
TCGGCCTTGACCGTTGCTTCCCTCGTCCTGCTCAAGTCGCCGCAGCCCATCGATCCCACCCGTCCGCTCACGTCC
CAAATCTTCATCACCAACCTCCCGGGCCCTGCCTCGCTCAACGCCGCTGTGGGGGAGCACGGCGCAACTCTTTCG
CCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTACTTCGACGCCAATACCCGCAGTCAGCAG
GCGGCGAATGGTGCCAGGGGCCGAACCGAGGTCGACGCCAAGACGGGCATCCCCGTCACCAAGAAGAGGCTCAAC
GACTTGGAGCTCAGCCTGCTTCACCTTCAGCAAAACGTCGACATCCCCGACATCTCCCTGACCTTTCACTCCATC
GTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGGCCTTCGCTCGACTCTATACCCGCCAACCTGCTG
CAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGGATCAAGTCCATCCAGGGCATCACCAAG
ATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCCAGTCAAGAGGTCAATTTTTGGCTCTCG
ATGGAGTCCGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGCGTCCTACTCACACTCGAGATCCTCAAG
CACGCCAAGCGTTTTCAGGCCACCGTCAGCTTCACCGCTGACACGGGCCTCAAGGAGGCCATGGAAAAGGTGCAG
AAGTATAACCAGCTGATGCGTGACTTCCCCCTCGACGAGCTCCTCTCCGCCACGTCGCTGCCCAAGGTCCAGGAG
GCTATCGCCCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGCCCCTACCCCGTCAGGCGGGCCCTTCCC
CTGGTCGAGGCCATCTCGGCCGACTTGGACGACGTGCTCCGTCGGCTGCTGCCGGGCACCGAGCTCGTCGATCTC
GATTATCACGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTTAGGGTGTGGGAGGATAACGTCAAGGAG
TTTACCAACGTTGCGCGCGAAGTGACGCGTCGCCGGAACGAAAAGTTCATACCCATCAAGATCATCAGGAAGCAC
TCGGAGCTGGAGTCTCGTATCAAGTACGTCGGCACCTTTCGCGACAATCACGAGCAGCTCCAGCGGACCATTGTC
AACGTCCTGGGCCCCGGCGTCCAGGCGGCCGGCGGTGGCTCCGACGTCGCCACGGCCGCCACGGGCACCACAAGC
GGCGTCGTCATGGAAGACGTGGGCGGCGTCGACGCCGTCATGGAAGTCAAGCAGGCCTGGGAAGCGCTGCAGCAC
GTCGACTTGCTCGACGTTTCCGACCAGGGCAAGGAGCGGTGGGTTCGGGCTGAGAACCTGTACAACGAGCGGACG
ACTCGGGTGGAAAACTCGATTATTGCCCGGCTGCGAGACCGGCTCGCGACGGCCAAGACGGCCAACGAGATGTTC
CGCGTCTTTTCCAAGTTTAACGCGCTCTTTGTGCGGCCCAAGATCAGGGGCGCCATACAGGAGTATCAGAATCAG
TTGATGGACCATGTCAAGCAGGCCATCAACGGCTTGCACGAGCGCTTCAAGATGCAGTACGGTCACTCTGAGGCT
CACGCCATGGCCCAGCTCCGCGACCTGCCCCCCGTCTCGGGAGCCATCATCTGGGCGCGCCAGATCGAGTTCCAG
CTCGACGGCTACATGAGAAAGGTCGAGGCAGTCCTCGGTCCGGACTGGCATCTGCACGCCGAGGGACACAAGCTG
CGCGAGGAGAGCGACCTGTTCAAGCGCAAGCTCAACACGGCCCGCATCTTCGAGGCCTGGCTGGCGGACGTCGGC
CGGCGCAAGATCTCCATCGCCGGCCAGCTCTTCGACATCGCCCGGGTCAGGGCCGCCGGCGGTATCCTCGAACTG
GCCGTCAACTTTGATCCGCAGGTCATCACGCTCTTCAAGGAGACGAGGAACCTCGTGTGGCAGTCGTATTCCGTG
CCTCACGCCGTCGCCACCGTGTCCAAGGACGCGAAGCGGGTGTATCCCTACGCCGTCAGCTTGATGGAGAGCGTC
AGGACGCTCTCGCAGACGCTGCGGCAGGTTTCCGACATGGGCGAGGAGTCGATGCTGCTCAACGGCTACCGCAAC
GAGGTCTACAAGATGATCGGCGAGGGAGTGCCGCTGCGGTGGGAGTCGTTTATCAACTCGCACGAGCTCTTCTAC
GCCGACCAGCAGCGTCAGACGCCCCGAGCCCTGATGCCCGCGGCCGGTGCCGACTTTGGCAGCGTCGCCAAGGGC
ACGGAGAGCAAGCACGGCATGTTCATCCGGAGCTTCGCCGCCGCCGTCTCCGTCCTCCAGGCCAAGGCCACGTCT
CTGATGCACATTCACGCCACGGTCGAGCAGGCGCTCAGGGAGCTGGGCACCTGTCCCTACGATGCCTCGGCCTTC
CAGCCGCGCCTCAGCACCATCCAGGCCGCCGTCGACCAGCTGAACCTGGAGCAGTACGTCAACCTCGACTACTGG
GTGCGCGGCCTGAACCAGAAGATCCAGTCCATCCTGCTCGGCCGCCTGCACGCCGCCATCCAGGCCTGGATCTCC
GCCTTCGAGGAAGACACGCCGGACGATGGGGGCCGCCGAGCGAAGACGGCGGGTGGCGACGACGACGACGACAGG
CAGCACGGCCCGGCCATGAAGCGTCTGGTGCTCGAGCTGGCCATGCGGAACCAGGTCATCTACCTGGACCCTGCC
CTGGAGCACGCCCGGGCCAGCTGGTTTCTCCTGCTCCACGACTGGATCGGCATCGTCTGTGACCTTCGCAAGATC
AAGGCGACCAGGTATCAGATGAGCATCACAACCAGCGCCGCCGCCGACGAGCCGCGCTTCTCGGACCTGCCGACC
GAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAGAAGAAGCTGCAAGAGGTCGGCGCCTACGTCGAC
AAGTGGCTCCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAGCAGGTCTACGACATGCTGGGCGACCACCTCCCG
CGATGGCTCGAGTGCCTGCAGGACATCCGCAAGGTTCGAACCACGTTTGATACGCAAGAGGTCAGCCGCTCGTTC
GGGCACATCACCATCGACTACGACCAGGTGCAGACAAAGGTCAACGCAAAGTACGATCAGTGGCAGCACGAGATC
CTCATCAAGTTCGCCGGAAGACTGGGCAACCGCATGCGCGACGTGCACGCCGAAATCGAAAAGGCGCGCAAGCAT
CTCGAGGGCCAGAGCTCTGACACGTCGTCGACGGCGCAGGCGGTTCAGTTCATCACGGCCGTGCAGAGCTGCAAG
CGCAATGTCAAGCTGTGGGCGCCTGAGATGGACCTCTTTCGTCAGGGGCAGTCGACGCTGGTGCGCCAGCGATAC
CACTTCCCGCAGGACTGGCTTCACATCGAGCAGGTCGATAGCCAGTGGGAGGCGCTCAAGGAGATACTCGACAAG
AAGTCGCGCATCATGGAGGAGCAGTCGGATGCGATGAGGGCCAACATTACGGCGCAGGACAAGCTGGTCAATGAG
CGCATCTGCGAGATCGTCGCGCTGTGGAACGAAGAGAAGCCCGTCTCCGGGACCATCCAGCCCGATGTGGCCTCG
GCCACGCTGGCTTCGTTCGAGTCTCGCATCGCCAGTTTGCAGGAAGAGTTTCTGCAGGTCGTCAAGGCCAAGGAG
GCGCTCGACATCGCCGCCTCGCACGACAGCTCCTTGGAGGCGACGCTCGAGGAGGTCCGGGACTTTCAGTCGGTC
TGGTCCAGCCTCTCGACCATATGGGCGAGCCTCAACGAGACGCGCGACATGCTCTGGACGGCCGTACAGCCGCGC
AAGGTGCGCAGCAAGGTCGAGGACCTCATCAAGAGCACCAAGGAGATGCCCAGTCGCATGAGGCAGTACGCCGCT
TTCGAACACGTCCAGGGCATCCTCCGAGGCTTCCTCAAGGTCAACGCCATCCTGTCGGACCTCAAGTCGGACGCG
ATCCGCGAGCGGCACTGGCAGAAGATATACAAGCAGATCCGGCCGCAGAGGCGCTTCTCGCCGAGCTCCATGACG
CTGGGCGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCCGTTGTCAAGGACATCATCGCCCAGGCGCAGGGC
GAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACGTGGCAGAACTACGCGCTCGAGATGGTGAATTAC
CAGAGCAAGTGTCGCCTCATCCGCGGCTGGGACGAGCTCTTTGCCAAGTGCAGCGAGAACCTCAACTCGCTGCAG
GCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAGGAGGAGGCCGTGGCGTGGGAGGACAAGCTCAACCGGGTC
CACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGCCAATGGGTCTACCTCGAGGGCGTATTCACCGGCAATGCC
GACATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTCCAGAACATCAACAGCGAGTTCCTGGCCGTCATGAAG
AAGGCCAACAAGACGCCCTACGTGCTGGACGTCCTCAACATCCCCAACGCCCAGAAGTCGCTGGAGCGCTTGGCC
GAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTGGAGAAGGAGAGGGTCTCGTTTCCGCGCTTCTAC
TTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGTAACAGCAACGACACGCTGCGCATCGCCAAGCACTTTAAG
AAGATGTTCGCCGGCCTTTCGGGTCTGGTCATGGACGACGAGTCGGTCATCACGGGCTTCACCTCCAAGGAAGGG
GAGATGGTCAAGCTGAAGAAGGAGATATCCGTGGCCAAGACGCCGAGGATCAACGACTGGCTGGCGCTGCTCGAG
GGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCCGTGGATCGGTACGCGCCCCTGTTCGAGGCCGAC
GACGACCTGTTGGACGGCGCGCTGAGGCGCTTCATGGACGAGTACCCGAGTCAGGTGGTGGTTCTGGCCACGCAG
GCGGTGTGGACGACGGCGGTCGAGAAGTCGTTGGCCGGAGGCGGCGGTTCGCTGCCGGCGCTGCTGGAGCGCGAG
ATGCAGGTCCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTCGACGTCATCCTGCGCAAGAAGTGCGAGCAG
CTCATCACCGAGTGCGTCCATCAGCGGGACGCCGTCGAGAAGCTCGTCGAGGCCGGAGCCGACAATGCCGGCCAT
TACCTGTGGCTGCTCCAGATGCGTTACGTCTACACGCCCGAGGGGGACTTCCTCGGCCGGCTGCACGTCAGCATG
GCCAATGCCAAGCTCAACTACGGCTTCGAGTACCTGGGCGTCCCGGACCGTCTCGTGCGGACGCCCCTGACGGAC
CGGTGCTTCCTCACCTTGACGCAGGCTCTGTGCCAGCGTCTGGGGGGTTCGCCGTACGGCCCGGCCGGCACGGGC
AAGACGGAGTCGGTCAAGGCTCTCGGCCTTCAGCTCGGCCGCTTCACGCTCGTCTTCTGCTGCGACGACACGTTC
GACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATATGCCAGGTCGGCGCCTGGGGATGCTTCGACGAGTTCAAC
CGGCTCGAGGAGAGGATCCTGTCGGCCGTGTCGCAGCAGATTCAGAATATCCAGCTCGGCCTCAGGCAGGGTGCC
GAGGACGACGCGTCGTCGCAGATCGAGCTGGTCGGCCGCCAGCTGAGCGTCAATGAGAACACGGGCATCTTCATC
ACCATGAACCCGGGCTACGCTGGCCGTTCCAACCTGCCGGACAACCTCAAGAAGCTCTTTCGCAGCGTGGCCATG
TCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCCCAAGGCTTCAGCCAGGCCAAGCGGCTGTCC
AAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCGGGCCGGCTCTCGAAGCAGGCTCACTACGACTTTGGTCTCCGT
GCCCTCAAGAGCGTCCTCGTCAGCTCGGGAGGGCTCAAGCGCGCCCGTCTCAACGACGGCGGCGAGGACGAGGGC
GTGGTGGAGCCGGAAATCATCGTGCAGAGCATCCGCGAGACCATCGCGCCCAAGCTGATCAAGGCCGACGTGGAG
CTCATGACGGGCATCGAAGCCGACTGCTTCCCCGGCGTTCCGTACGTGCCGGCCAACCTCGGGGACCTGGAGGAG
GCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACGGACACGTGGATGACCAAGATCCTCCAGCTGTAC
CAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAACTCGGGCAGCGGCAAGTCGGCCGCCTGGAGGTTG
CTGCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTCTTCCACGTCATCGACTCCAAGGTCATGTCCAAG
GAGGCCCTCTACGGCAACCTGGATCCGACGACGCGCGAGTGGACCGACGGCCTGTTCACGAGCATCCTGCGCAAG
ATTGTGGATAACCTCAGGGGCGAGGACGCCAAGAGGCATTGGATCGTCTTCGACGGCGACGTCGATCCGGAATGG
GTCGAGAACCTCAACAGCGTGCTCGACGACAACAAGCTGCTGACGCTGCCCAACGGCGAGCGGCTCAGCCTCCCG
GCCAACGTCCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCGACGCTGGCGACGGTCAGTCGCTGCGGCATG
GTCTGGTTCAGCGAAGACACGGTGACGCCGGACATGCTGGTGGCGCACTATCTCGAGACGCTGGGCAGCGTCCCC
TTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGCCAGGCGCCGGCGCGGATCCTGGCCGTTCAGGCCCGGGTG
GCCGACCTGCTGCGGTCGCATCTCTGTGCCGACGACTTCGTGGCCCGGGTGCTGGCGAGGGCTCAGGAGTACGAC
CACATCATGGACTTTACCGTCGCCCGCGTCCTCACCACGCTCTTCTCGCTCCTCAACAAGGCGGTGAGGGACGTG
ATCGAGTACAATGGCCGGCACGCAGACTTTCCCCTGGACGCGGACCAAGTCGAGGCCTTTGTGCCCAAGAAGCTG
CTGCTGGCGCTGGTGTGGGCTCTGACGGGCGACTGTCCGCTGGCTGACCGCAAGGCCTTCGGCGACGACGTCTGT
GCCATGGCCAGCTTCGGGTCTCCGCCCCTGGACGGCAGCGGCAGCTCGCTCATCGATTTCGACGTCAGCCTGCCC
AGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCTACCGTCGAGGTCAACACGCACTCGATCACGCAGACGGAC
GTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGACGTGCTCTACTCGTGGCTGGCAGAGCACAAGCCCTTG
CTGCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTCTTCAGTGCCCTCCGCAAGCTGCCCAACATGGAG
GTGGTCGGCCTCAACTTCTCCAGCGCGACGACGCCGGGCCTCCTCATCAAGACGTTTGAGCAGTATTGCGAGTAC
AAGAAGACGCTCAACGGCGTGATGCTCTCGCCCACGCAGATCGGTCGTTGGCTCGTCGTCTTTTGTGACGAGATC
AACCTGCCGGCTCCGGACAGGTACGGCACGCAGCGGGCCATCTCGTTCCTGAGGCAGCTGGTGGAGCACAACGGC
TTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGGATCCAGTTCGTCGGCGCCTGCAACCCGCCCACG
GACGCGGGCCGGACGGCGCTCGGGGCTCGCTTCCTCCGGCACGCGCCGCTCGTCATGGTCGACTACCCGGGCGAG
CTCTCGCTCAACCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAGGTGGTGCCGTCGCTGCGCGGGTACGCC
GAGGCGCTGACGCAGGCCATGGTGCGCTTCTACCTCGAGTCGCAGCGGCGGTTCACGCCCGAGATACAGCCGCAT
TACGTCTACAGCCCGCGCGAGCTCACGCGCTGGGTCAGGGGCGTGTACGAGGCCATCCGGCCGCTCGAGGGGCTG
TCGGTCGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTGCGCCTCTTCCAGGACCGGCTGGTGGACGAGTCG
GAGAGGGCGTGGACGGACGAGGCCGTCCGACGCATTGCCTCGGAGCACTTCCCCAACGTCGACGAGGAGAAGGCG
CTGGGCGGGCCCATCCTGTTCTCCAACTGGTTGTCGCGCAACTACGTGCCGGTCGAGAGGGAGCGGTTGCGCGAG
TTCGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTGGACGTGCCGCTGATCCTGTTCAACGACGTGCTG
GAGCATGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGTCATTTGATACTGATTGGCGTCAGCGGCAGC
GGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGCCTCAAGGTGTTTCAGATCAAGGTGCACGGCAAG
TACTCGGCCGACGACTTCGACGAGGACCTGCGGGACGTGCTGCGGAGGTGCGGCTGCAAGGGTGAGAAGATGTGC
TTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTGGAGCGCATGAACACGCTGCTGGCCAACGCCGAG
GTCCCCGGCCTGTTCGAGGGCGACGAGTACGCGGCCCTGATGACGGCCTGCAAGGAGGGGGCGCAGCGGCAGAAC
CTGCACCTCGACTCTCCCGAAGAGCTGTATCGCTGGTTCACGCAGCAGATCGTCAACAACCTGCACGTCGTCTTC
ACCATGAACCCGCCCGAGGGGGGGCTGTCGTCCAAGGCGGCGACGAGCCCGGCGCTGTTCAACCGTTGCGTGCTC
AACTGGTTCGGCGACTGGTCGGACCAGGCGCTCTTCCAGGTCGGTCACGAGCTGACGCAGTCGGTCGACCTGGAC
CGCGGCGCATACCGGGCTCCCGACTCGATACCGGCGGCGTATCGGGGCCTGTCGATGCCGCCGACGCACCGCGAG
GCCGTGGTCAACTCGATGGTCCACATCCACTACTCGCTGGGGCGGTACAACGAGAAGCTGCTCCGGCAGCAGAAC
AAGCTGACCTTCCTGACGCCGCGGCACTTCCTCGACTTCGTGGGCCAGTTCGTGCGCTTGTACAACGAGAAGCGG
GAGGACCTGGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTCGAGAAGCTGCGCGACACGGTGGACAAGGTGCGC
GATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAGCGCAAGGACGCCGAGGCCAACGAGAAGCTGCAG
CGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGCGGACGACGTCGCTGGAGATTCAGCAGGCGTTGGAGAAG
CAGGAGGCCGAGGTGGCGACGCGGCGACGGGTCGTGCTGGAGGACCTGGCCAAGGCCGAACCGGCCGTCGAGGAG
GCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACGGAGGTGCGGTCGATGGGCAACCCGCCTCAGGGG
GTGAGGCTGGCGCTCGATGCCGTCTGCACGCTGCTGGGCCACCGGATCGTGGACTGGAAGGCGGTGCAGGCCGTG
GTCCGGCGAGACGACTTCATCGCCAGCATCATCATGTTCGACAACGGGCGGCAGATGACGAGGGCTCTGCGGGCC
AAGATGCGCAACGACTTCCTCTCCAACCCGGAGTTTACGTTCGAAAAGGTCAACAGGGCGTCCAAGGCGTGCGGT
CCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCGGACATACTGGACCGCGTCGGGCCGCTCAAGGACGAG
GTCGGCCGGCTGGAGGAACGGGCGCTGCAGACGAAGGCCGAGGCTCGGGCGGTCGAGGCCAACATCGGCGCGCTC
GAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTCATCAGCGAGACGCAGGCCATCAAGTCGGAGATG
GCAAAGGTCCAGTTCAAGGTGGACCGCAGCGTCCGGCTGCTCGACAGCCTGTCTTCGGAGAGGACCCGATGGGAG
GAGGGCAGCCGGTCGTTCGAGACGCAGATCGGCACGCTGGTGGGCGACGTGCTGGTGGCGGCCGCCTTCGTGGCC
TACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCCATGATGGACGACTGGTGCCATCAGCTTCACCTCTCGGGC
ATCCTGTACAAGTCGCCCAACCCGGTGACGGACTATCTGTCGACGGCGGACGAGCGGCTGGGCTGGCAGGAGAAC
ACGCTGCCGGCGGACGACCTGTGCACGGAGAACGCCATCATCCTGAAGCGCTTCAACCGCTATCCCCTCATCATC
GATCCGTCGGGGAGGGCGACCGAGTTCCTGCAGCGCGAGTGTCGCGACAGGCGGCTGACGGTGACGAGCTTCCTC
GACGACGGCTTCACCAAGCAGCTCGAGAGCTCCCTGCGCTTCGGCAACCCGATCCTGATACAGGACGCCGAACAC
CTGGACCCCATCCTCAACCACGTGCTCAACAAGGAGTATCAGCGCACGGGGGGCCGGGTGCTGATGCAGCTGGGC
AAGCAGGAGATTGACTTCTCGCCCTCGTTCCGCCTCTACCTTTCGACGCGCGATCCGTCGGCCCAGTTCGCGCCC
GACATCTGCAGCAGGGCTACCTTTGTCAACTTCACCGTCACAAAGGGCAGCTTGCGGACGCAGTCGCTCAACGAC
GTGCTCAAGTCGGAGCGGCCCGACGTCGACGAGCGCCGGACCGACCTCATCAAGCTGCAGGGAGAGTTCAAGGTT
CACCTACGCCAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAACGAGTCGCGCGGCAACATCCTCGACGACGACAAG
GTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCCGCCGACATCTCGGCCAAGATGAGCAGCACCGAGGGCGTC
ATGGCCGAGGTGGAGGACATCACGAGACAGTACGGCGTCATCGCCAACTCGTGCAGCGCCGTCTTCGCCGTGCTG
GATCAGCTGCACTTTCTCAACCACTTCTACCGCTTCTCGCTGCATTACTTCCTCGACATCTTCCGCACGGTCCTG
CACGGCAACGCCAATCTCGAGGGCGTGGCCGATCACCACGGCCGTCGCGACATCATCGTCCGCGACCTGTTCGTC
AACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGACCGCATAACGCTGGCGGTGCTGCTGGCTCAGGCG
TCGCCCTACGCCATGGACAGGGGGCTGATGGACGCGGTGCTCGACGGCGACGTCCGGGGTCGCGACCTGTCGTCG
GAGGAGGGGGCGGGCGAGGAGGCGCGTCGAGAGGCCATGACCCGGGCCGGACGGCTGCCCGCGCTACGGGGCCGG
CTGGGGAGGGTGTCGGGCGAGGAGTGGGAGCGCTTCCTCACGGACGAGCTGGCCGAGGACTGCGTCCCGCGGGGG
CTGTTGTCGGGCGGCGGCGGCGGTGACGGAGAAGATGATGAGGGGGCCGAGGGGGCCGAGGGGGCCGAGGGTGCC
GAGATGCGGACGCTGAGCCCCGTCGACGAGGCTCTCCTCTCGCTGCTCGTCGTCAAGCTGTTCCGGATGGACCGG
TTCGTGCCGGCGGCCGAGCGGTTCGTGGGCCGCGTCTTCGGGCCCGAGATGCTGGACCACGTCGAGGACCTCGCC
GAGACGGTCGGCCAGGTCTCGGCCACGGTCCCCCTCGCGCTCGTGTCCAGCCCGGGCTTCGACGCCAGCTACAAG
GTCGACGGGCTGGTGGAGCGAAAGGGGGTGCGGTGCACCAACATCGCCATGGGCTCCAACGAGGGCCTGGCCAGC
GCGGACAAGGCCATCAGTCACGCCGCCCAGACGGGATCGTGGGTCCTGGTCAAGAACGTCCACCTGGCGCCCACC
TGGCTGCAGAGCCTGGAGAAGCGGATGGAGGCGCTGAGCCCGCAGGACGACTTCCGGCTGTTCCTGTCGATGGAG
TCGAGTCCGCGGATCCCGGTGAACCTGATCCGGGCGTCGAGGGTGCTCATGTACGAGCAGCCGGCCGGGGTGAGG
GCCAACATGAAGGACTCGATGTCTTCGCTCTCGACGAGGGCGGGGAGGGCGCCGGTCGAGAGGGCGAGGCTTTAC
CTGTTGATCTGCTTCCTGCACGCCGTCGCGCAGGAGAGGTTGCGGTACGCGCCGAGTCTGGGGTGGAAGGGGTTC
TGGGAGTTTAACGACAGCGATGTGAGTTTTTTTTTTTGTGTTTCGAGACGTCTTCGCGTGTGTTGAAGGAACCAA
AAAAAAAAAAAAAAAAAAAAAAAGAAGGGAACGCTGACGGGGGGAGACGTGTTCAGTATGAGTGCTCGGCTTTCA
TCATCGATACCTGGCTGGAGAGGACGGCCGGACGGCGAAGCAACATGGCCCCGGCCAACATGCCGTGGGAGATGA
TGCGGCATCTCGTCAGCGAGACGTACGGCGGCAAGATCGACGACGAGGAAGACCTGAAGCTGCTGCGGAAGCTGG
TATGGTCTCTCCTGACGCCGACGGCCTACGACGCGGACCACCAGCTCATGGGCGGGCTCCGGTTGCCGTCGGGGA
CGAGCGTGCAGGACTTTATGGGCTGGATCCACGAGTTGCCGGAGAGGGAGCCGCCGACGTATCTGGGGTTGCCGG
CGGACGCGGAGAAGTTGTTGCTGGTGGGGATGGGGAGGAGGTTGGTTGGGGATGTGGGGAGGGTGACGGAGTTGT
TGGATCAGGGGAGCAGCTCGTTACGGAGGGGGAGTAGGGGAGTGGAGAGGAGAGGGAGGAATGTTTGTGGGTTGT
TGGTATTTGCGGTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGT
GGTGGTGGTGGTGGTTGTGGTTGTGGTTGTGGTGGTGGTTGTGGTGGTTGTAGTGGTTGTAGTAGTTGTGATTGC
GGTGGTTGTGGTGGTGCTGAAACACAGCCAGCCTAGACACCTATAAATAGAGCAATATCTGCGTGTGAGTGAGTC
GACTGTCTCACCGTGTTCTACATACACCTACATATGTATGTACAGCCGGTCTACGGATACAGGCTCACCTACCTA
CCCTACCAAGGTAGACACAGTAAGCGGAGCTGGTAGTCCGGGGCTCGAGCCGGGCGGTTGCAGAGCATGTCGTCA
TGGTCTTGGCATGCACGTATGTATGTATGTATATTGTCTGTACGTATGTGTATGTATGTGTATTCGTGTGTATGT
ATTCGTGTGTATGCACAAACTGCGTACCAAGTACGACGTCATCTTCACCTACATAGTACGAATACCCAGCACCAG
CAATCCTCCGTGATGAGGCGTATGTATGTATCGTATGTATTGAACGAATACGCCCGCATATGTAGGTATGCTCTG
ACTCTCTCCTCTCTCTCTCTCTCTCTCTCCCTCACACACACACACACACACACAGTGCACGCACGCGTCCACTCG
TCACCCGGCTGTCTCATCCCGTCATCCCCGCATGTTGGCTCGAGGTATTCGTACGGTGCGGTTGCCGGCTTACTT
ATAGATAGATGTTGGGGGGGAAGTTCGTCTCCCCCTCTTTCTTGTCTTTTTTTTTTTTTTTCTTGTCTCCTTTTC
TACTTTCTTCTCAAACGTTTGCCACGCTTTCTTTCTAGGAGAGAGCGATATTCGCCATGGCTAACTGGCAGCAGT
GTTTGTCTACCCCCGAATTCCCCCCCCCCCCCAAAATCCACAGCACATCTAACCTATCGTATGTACGGAATACAC
CCTCAGATAACCCCTTCAGCAAGCGCGAATCCCATAGCGCGGCCTCCATCACAACCTACAAGATCCTCACCCTCC
TAACCTGGATCCTCTCCGTCGTCGTCTCCATCTACTACACCGTCCACGCGCCCCACGATGGCTTCACCATCCGTC
ACCGCATCTGGGACCAGAATTACCTGTACCCCAGCGCCTTCACCATGAATCACGTCCTCGCCGACATCTACTGGC
TCGTCCTCTTCATCCTTCAGGCCGGTTACGTGGCGCACCTCTTCTCCGGCAAGTCCGAGACGGTGTACGCTGCCT
CTTCGGTGGGGAGTCACTTCGTGCTGAACAACCTGCTGCACTTTGCCTTTGTCATGTTGTTTGTGCGGTCGCATT
TTCATTGGGCTGAGGTCATGCTCGTCATCAACTTTGTCAACCTCAGCTCTCTGTACTTTCGCCATCATGCGCATG
GGCGATTCATCCATGGGCCTGCCGTTTCGGGGCCTTTGGCTTGGACTTTTGTCGCCATTTATTGGAACGGGGCCA
TCATGGTGCCGCATCAGCATAATCTCGTGGCCCGCGTGTTTGGCAACATCTTCATCTGGTCCATCCTCGGCTACG
GAGCCTTCTTCATCGTTGCTTACAAGGTGCGTCGCATCTACCGAAAATTCAACCCTCCTTCGAGATGGGCTGTGC
TGATTCTACTCGACAGGACTACACCATGGGCTTCGCGCTCAGCGTCCTGGCTGCGGCCATTGGCGTGGCGCAGTT
TGAGAGGCAGGTCGTTGCCTTGCAGTGGATCTTCGCCTTTGTCATCATGGCGGTTTTGTTCGTCATGACGCTGGT
GGTTGCTTTGCCGGCTTGGGCGGGTAGGGATTTGAGGTGGAGGCGGGCTGAGGCTGATCAGGAGAGGGCGCCTTT
GCTGGAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail