Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03945
Gene name
Locationscaffold_04:429044..444282
Strand-
Gene length (bp)15238
Transcript length (bp)13944
Coding sequence length (bp)13944
Protein length (aa) 4648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12774 AAA_6 Hydrolytic ATP binding site of dynein motor region 5.9E-126 1916 2254
PF08385 DHC_N1 Dynein heavy chain, N-terminal region 1 6.9E-120 265 851
PF08393 DHC_N2 Dynein heavy chain, N-terminal region 2 6.1E-119 1371 1773
PF12781 AAA_9 ATP-binding dynein motor region 2.2E-76 3581 3799
PF12780 AAA_8 P-loop containing dynein motor region D4 2.3E-63 2926 3204
PF12775 AAA_7 P-loop containing dynein motor region 1.2E-34 2580 2754
PF12777 MT Microtubule-binding stalk of dynein motor 6.9E-37 3219 3550
PF08611 DUF1774 Fungal protein of unknown function (DUF1774) 3.2E-36 4552 4645
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.7E-12 2242 2376
PF07728 AAA_5 AAA domain (dynein-related subfamily) 9.5E-05 2950 3106
PF18198 AAA_lid_11 Dynein heavy chain AAA lid domain 1.3E-26 4207 4349
PF03028 Dynein_heavy Dynein heavy chain region D6 P-loop domain 1.7E-25 4067 4173
PF17852 Dynein_AAA_lid Dynein heavy chain AAA lid domain 2.5E-12 2445 2568

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0030286 dynein complex Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0008569 minus-end-directed microtubule motor activity Yes
GO:0007018 microtubule-based movement Yes
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0007017 microtubule-based process No
GO:0009987 cellular process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032991 protein-containing complex No
GO:0003824 catalytic activity No
GO:0003777 microtubule motor activity No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:1902494 catalytic complex No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0005875 microtubule associated complex No
GO:0005575 cellular_component No
GO:0032555 purine ribonucleotide binding No
GO:0003774 cytoskeletal motor activity No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0140657 ATP-dependent activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 4381 4403 22
2 4424 4446 22
3 4461 4483 22
4 4490 4509 19
5 4519 4541 22
6 4553 4572 19
7 4603 4625 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03945
MEVSSSASPSNGVASPSFPTIEPERVVDHLAAVCEIALGATKLQLEQPGNLLHKSRYAETISRCTRFANDAQSVL
YVQKDVAPSSAPENGAESAAPANFLYTLSTELSASALTVASLVLLKSPQPIDPTRPLTSQIFITNLPGPASLNAA
VGEHGATLSPWEVLHSQVHHALVPYFDANTRSQQAANGARGRTEVDAKTGIPVTKKRLNDLELSLLHLQQNVDIP
DISLTFHSIVQNVVEEAEARHTRPSLDSIPANLLQDSTFLNRLQANVNTWIKSIQGITKMTKDPSPGANQEFSTA
SQEVNFWLSMESALESIEGQLRSEGVLLTLEILKHAKRFQATVSFTADTGLKEAMEKVQKYNQLMRDFPLDELLS
ATSLPKVQEAIAQIFGHLNKKLRICPYPVRRALPLVEAISADLDDVLRRLLPGTELVDLDYHEFQALMRTCDGIF
RVWEDNVKEFTNVAREVTRRRNEKFIPIKIIRKHSELESRIKYVGTFRDNHEQLQRTIVNVLGPGVQAAGGGSDV
ATAATGTTSGVVMEDVGGVDAVMEVKQAWEALQHVDLLDVSDQGKERWVRAENLYNERTTRVENSIIARLRDRLA
TAKTANEMFRVFSKFNALFVRPKIRGAIQEYQNQLMDHVKQAINGLHERFKMQYGHSEAHAMAQLRDLPPVSGAI
IWARQIEFQLDGYMRKVEAVLGPDWHLHAEGHKLREESDLFKRKLNTARIFEAWLADVGRRKISIAGQLFDIARV
RAAGGILELAVNFDPQVITLFKETRNLVWQSYSVPHAVATVSKDAKRVYPYAVSLMESVRTLSQTLRQVSDMGEE
SMLLNGYRNEVYKMIGEGVPLRWESFINSHELFYADQQRQTPRALMPAAGADFGSVAKGTESKHGMFIRSFAAAV
SVLQAKATSLMHIHATVEQALRELGTCPYDASAFQPRLSTIQAAVDQLNLEQYVNLDYWVRGLNQKIQSILLGRL
HAAIQAWISAFEEDTPDDGGRRAKTAGGDDDDDRQHGPAMKRLVLELAMRNQVIYLDPALEHARASWFLLLHDWI
GIVCDLRKIKATRYQMSITTSAAADEPRFSDLPTECAGMLHRVYVSVEKKLQEVGAYVDKWLQFQSLWDLQSEQV
YDMLGDHLPRWLECLQDIRKVRTTFDTQEVSRSFGHITIDYDQVQTKVNAKYDQWQHEILIKFAGRLGNRMRDVH
AEIEKARKHLEGQSSDTSSTAQAVQFITAVQSCKRNVKLWAPEMDLFRQGQSTLVRQRYHFPQDWLHIEQVDSQW
EALKEILDKKSRIMEEQSDAMRANITAQDKLVNERICEIVALWNEEKPVSGTIQPDVASATLASFESRIASLQEE
FLQVVKAKEALDIAASHDSSLEATLEEVRDFQSVWSSLSTIWASLNETRDMLWTAVQPRKVRSKVEDLIKSTKEM
PSRMRQYAAFEHVQGILRGFLKVNAILSDLKSDAIRERHWQKIYKQIRPQRRFSPSSMTLGDVWDLNLVATEAVV
KDIIAQAQGEMALEEFLKQVRETWQNYALEMVNYQSKCRLIRGWDELFAKCSENLNSLQAMKHSPYYKEFEEEAV
AWEDKLNRVHVLFDVWIDVQRQWVYLEGVFTGNADIKHLLPIESGRFQNINSEFLAVMKKANKTPYVLDVLNIPN
AQKSLERLAEMLNKIQKALGEYLEKERVSFPRFYFVGDEDLLEMIGNSNDTLRIAKHFKKMFAGLSGLVMDDESV
ITGFTSKEGEMVKLKKEISVAKTPRINDWLALLEGGMKSTLAELLAEAVDRYAPLFEADDDLLDGALRRFMDEYP
SQVVVLATQAVWTTAVEKSLAGGGGSLPALLEREMQVLGVLADTVLGDLDVILRKKCEQLITECVHQRDAVEKLV
EAGADNAGHYLWLLQMRYVYTPEGDFLGRLHVSMANAKLNYGFEYLGVPDRLVRTPLTDRCFLTLTQALCQRLGG
SPYGPAGTGKTESVKALGLQLGRFTLVFCCDDTFDFQAMGRIFLGICQVGAWGCFDEFNRLEERILSAVSQQIQN
IQLGLRQGAEDDASSQIELVGRQLSVNENTGIFITMNPGYAGRSNLPDNLKKLFRSVAMSKPDKELIAEVMLYSQ
GFSQAKRLSKQTVPFFEQCSGRLSKQAHYDFGLRALKSVLVSSGGLKRARLNDGGEDEGVVEPEIIVQSIRETIA
PKLIKADVELMTGIEADCFPGVPYVPANLGDLEEAIRVLAAERHLVVTDTWMTKILQLYQIQKIHHGVMMVGNSG
SGKSAAWRLLLDALQKVEGVEGVFHVIDSKVMSKEALYGNLDPTTREWTDGLFTSILRKIVDNLRGEDAKRHWIV
FDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPANVRIMFEVETLRYATLATVSRCGMVWFSEDTVTPDMLVAH
YLETLGSVPFEDLDEDSVATGQAPARILAVQARVADLLRSHLCADDFVARVLARAQEYDHIMDFTVARVLTTLFS
LLNKAVRDVIEYNGRHADFPLDADQVEAFVPKKLLLALVWALTGDCPLADRKAFGDDVCAMASFGSPPLDGSGSS
LIDFDVSLPRAEWTPWQDQVPTVEVNTHSITQTDVVIPTLDTVRHEDVLYSWLAEHKPLLLCGPPGSGKTMTLFS
ALRKLPNMEVVGLNFSSATTPGLLIKTFEQYCEYKKTLNGVMLSPTQIGRWLVVFCDEINLPAPDRYGTQRAISF
LRQLVEHNGFWRTSDKSWVTLDRIQFVGACNPPTDAGRTALGARFLRHAPLVMVDYPGELSLNQIYGTFNAAVLK
VVPSLRGYAEALTQAMVRFYLESQRRFTPEIQPHYVYSPRELTRWVRGVYEAIRPLEGLSVEGLMRVWAHEALRL
FQDRLVDESERAWTDEAVRRIASEHFPNVDEEKALGGPILFSNWLSRNYVPVERERLREFVKARLKTFCEEEVDV
PLILFNDVLEHVLRIDRVFRQPQGHLILIGVSGSGKTTLSRFVAWMNGLKVFQIKVHGKYSADDFDEDLRDVLRR
CGCKGEKMCFIMDEANVLDSGFLERMNTLLANAEVPGLFEGDEYAALMTACKEGAQRQNLHLDSPEELYRWFTQQ
IVNNLHVVFTMNPPEGGLSSKAATSPALFNRCVLNWFGDWSDQALFQVGHELTQSVDLDRGAYRAPDSIPAAYRG
LSMPPTHREAVVNSMVHIHYSLGRYNEKLLRQQNKLTFLTPRHFLDFVGQFVRLYNEKREDLEEQQRHLNVGLEK
LRDTVDKVRDLRASLADKKTQLERKDAEANEKLQRMVADQREAEQRRTTSLEIQQALEKQEAEVATRRRVVLEDL
AKAEPAVEEAKASVSNIKRQHLTEVRSMGNPPQGVRLALDAVCTLLGHRIVDWKAVQAVVRRDDFIASIIMFDNG
RQMTRALRAKMRNDFLSNPEFTFEKVNRASKACGPLVQWVAAQVNYSDILDRVGPLKDEVGRLEERALQTKAEAR
AVEANIGALEASIDTYKTEYAALISETQAIKSEMAKVQFKVDRSVRLLDSLSSERTRWEEGSRSFETQIGTLVGD
VLVAAAFVAYSGLYDQTFRKSMMDDWCHQLHLSGILYKSPNPVTDYLSTADERLGWQENTLPADDLCTENAIILK
RFNRYPLIIDPSGRATEFLQRECRDRRLTVTSFLDDGFTKQLESSLRFGNPILIQDAEHLDPILNHVLNKEYQRT
GGRVLMQLGKQEIDFSPSFRLYLSTRDPSAQFAPDICSRATFVNFTVTKGSLRTQSLNDVLKSERPDVDERRTDL
IKLQGEFKVHLRQLEKQLLQALNESRGNILDDDKVIETLETLKTEAADISAKMSSTEGVMAEVEDITRQYGVIAN
SCSAVFAVLDQLHFLNHFYRFSLHYFLDIFRTVLHGNANLEGVADHHGRRDIIVRDLFVNTFKRTALGLLQKDRI
TLAVLLAQASPYAMDRGLMDAVLDGDVRGRDLSSEEGAGEEARREAMTRAGRLPALRGRLGRVSGEEWERFLTDE
LAEDCVPRGLLSGGGGGDGEDDEGAEGAEGAEGAEMRTLSPVDEALLSLLVVKLFRMDRFVPAAERFVGRVFGPE
MLDHVEDLAETVGQVSATVPLALVSSPGFDASYKVDGLVERKGVRCTNIAMGSNEGLASADKAISHAAQTGSWVL
VKNVHLAPTWLQSLEKRMEALSPQDDFRLFLSMESSPRIPVNLIRASRVLMYEQPAGVRANMKDSMSSLSTRAGR
APVERARLYLLICFLHAVAQERLRYAPSLGWKGFWEFNDSDYECSAFIIDTWLERTAGRRSNMAPANMPWEMMRH
LVSETYGGKIDDEEDLKLLRKLVWSLLTPTAYDADHQLMGGLRLPSGTSVQDFMGWIHELPEREPPTYLGLPADA
EKLLLERAIFAMANWQQYNPFSKRESHSAASITTYKILTLLTWILSVVVSIYYTVHAPHDGFTIRHRIWDQNYLY
PSAFTMNHVLADIYWLVLFILQAGYVAHLFSGKSETVYAASSVGSHFVLNNLLHFAFVMLFVRSHFHWAEVMLVI
NFVNLSSLYFRHHAHGRFIHGPAVSGPLAWTFVAIYWNGAIMVPHQHNLVARVFGNIFIWSILGYGAFFIVAYKD
YTMGFALSVLAAAIGVAQFERQVVALQWIFAFVIMAVLFVMTLVVALPAWAGRDLRWRRAEADQERAPLLED*
Coding >Ophcf2|03945
ATGGAGGTATCATCCTCTGCGTCGCCTTCAAATGGCGTCGCGTCGCCGTCTTTCCCGACCATCGAGCCCGAACGC
GTCGTCGATCATCTGGCGGCTGTCTGCGAGATTGCCCTGGGAGCAACGAAGCTTCAGCTCGAACAGCCTGGTAAC
CTGCTGCACAAGAGCCGTTACGCAGAGACGATCTCTCGATGCACACGATTTGCAAACGATGCTCAGAGCGTCCTC
TACGTTCAGAAGGACGTTGCGCCCTCTTCGGCGCCTGAGAATGGTGCCGAGTCTGCTGCCCCCGCCAACTTCCTC
TACACTCTCTCGACTGAGCTGTCTGCATCGGCCTTGACCGTTGCTTCCCTCGTCCTGCTCAAGTCGCCGCAGCCC
ATCGATCCCACCCGTCCGCTCACGTCCCAAATCTTCATCACCAACCTCCCGGGCCCTGCCTCGCTCAACGCCGCT
GTGGGGGAGCACGGCGCAACTCTTTCGCCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTAC
TTCGACGCCAATACCCGCAGTCAGCAGGCGGCGAATGGTGCCAGGGGCCGAACCGAGGTCGACGCCAAGACGGGC
ATCCCCGTCACCAAGAAGAGGCTCAACGACTTGGAGCTCAGCCTGCTTCACCTTCAGCAAAACGTCGACATCCCC
GACATCTCCCTGACCTTTCACTCCATCGTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGGCCTTCG
CTCGACTCTATACCCGCCAACCTGCTGCAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGG
ATCAAGTCCATCCAGGGCATCACCAAGATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCC
AGTCAAGAGGTCAATTTTTGGCTCTCGATGGAGTCCGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGC
GTCCTACTCACACTCGAGATCCTCAAGCACGCCAAGCGTTTTCAGGCCACCGTCAGCTTCACCGCTGACACGGGC
CTCAAGGAGGCCATGGAAAAGGTGCAGAAGTATAACCAGCTGATGCGTGACTTCCCCCTCGACGAGCTCCTCTCC
GCCACGTCGCTGCCCAAGGTCCAGGAGGCTATCGCCCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGC
CCCTACCCCGTCAGGCGGGCCCTTCCCCTGGTCGAGGCCATCTCGGCCGACTTGGACGACGTGCTCCGTCGGCTG
CTGCCGGGCACCGAGCTCGTCGATCTCGATTATCACGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTT
AGGGTGTGGGAGGATAACGTCAAGGAGTTTACCAACGTTGCGCGCGAAGTGACGCGTCGCCGGAACGAAAAGTTC
ATACCCATCAAGATCATCAGGAAGCACTCGGAGCTGGAGTCTCGTATCAAGTACGTCGGCACCTTTCGCGACAAT
CACGAGCAGCTCCAGCGGACCATTGTCAACGTCCTGGGCCCCGGCGTCCAGGCGGCCGGCGGTGGCTCCGACGTC
GCCACGGCCGCCACGGGCACCACAAGCGGCGTCGTCATGGAAGACGTGGGCGGCGTCGACGCCGTCATGGAAGTC
AAGCAGGCCTGGGAAGCGCTGCAGCACGTCGACTTGCTCGACGTTTCCGACCAGGGCAAGGAGCGGTGGGTTCGG
GCTGAGAACCTGTACAACGAGCGGACGACTCGGGTGGAAAACTCGATTATTGCCCGGCTGCGAGACCGGCTCGCG
ACGGCCAAGACGGCCAACGAGATGTTCCGCGTCTTTTCCAAGTTTAACGCGCTCTTTGTGCGGCCCAAGATCAGG
GGCGCCATACAGGAGTATCAGAATCAGTTGATGGACCATGTCAAGCAGGCCATCAACGGCTTGCACGAGCGCTTC
AAGATGCAGTACGGTCACTCTGAGGCTCACGCCATGGCCCAGCTCCGCGACCTGCCCCCCGTCTCGGGAGCCATC
ATCTGGGCGCGCCAGATCGAGTTCCAGCTCGACGGCTACATGAGAAAGGTCGAGGCAGTCCTCGGTCCGGACTGG
CATCTGCACGCCGAGGGACACAAGCTGCGCGAGGAGAGCGACCTGTTCAAGCGCAAGCTCAACACGGCCCGCATC
TTCGAGGCCTGGCTGGCGGACGTCGGCCGGCGCAAGATCTCCATCGCCGGCCAGCTCTTCGACATCGCCCGGGTC
AGGGCCGCCGGCGGTATCCTCGAACTGGCCGTCAACTTTGATCCGCAGGTCATCACGCTCTTCAAGGAGACGAGG
AACCTCGTGTGGCAGTCGTATTCCGTGCCTCACGCCGTCGCCACCGTGTCCAAGGACGCGAAGCGGGTGTATCCC
TACGCCGTCAGCTTGATGGAGAGCGTCAGGACGCTCTCGCAGACGCTGCGGCAGGTTTCCGACATGGGCGAGGAG
TCGATGCTGCTCAACGGCTACCGCAACGAGGTCTACAAGATGATCGGCGAGGGAGTGCCGCTGCGGTGGGAGTCG
TTTATCAACTCGCACGAGCTCTTCTACGCCGACCAGCAGCGTCAGACGCCCCGAGCCCTGATGCCCGCGGCCGGT
GCCGACTTTGGCAGCGTCGCCAAGGGCACGGAGAGCAAGCACGGCATGTTCATCCGGAGCTTCGCCGCCGCCGTC
TCCGTCCTCCAGGCCAAGGCCACGTCTCTGATGCACATTCACGCCACGGTCGAGCAGGCGCTCAGGGAGCTGGGC
ACCTGTCCCTACGATGCCTCGGCCTTCCAGCCGCGCCTCAGCACCATCCAGGCCGCCGTCGACCAGCTGAACCTG
GAGCAGTACGTCAACCTCGACTACTGGGTGCGCGGCCTGAACCAGAAGATCCAGTCCATCCTGCTCGGCCGCCTG
CACGCCGCCATCCAGGCCTGGATCTCCGCCTTCGAGGAAGACACGCCGGACGATGGGGGCCGCCGAGCGAAGACG
GCGGGTGGCGACGACGACGACGACAGGCAGCACGGCCCGGCCATGAAGCGTCTGGTGCTCGAGCTGGCCATGCGG
AACCAGGTCATCTACCTGGACCCTGCCCTGGAGCACGCCCGGGCCAGCTGGTTTCTCCTGCTCCACGACTGGATC
GGCATCGTCTGTGACCTTCGCAAGATCAAGGCGACCAGGTATCAGATGAGCATCACAACCAGCGCCGCCGCCGAC
GAGCCGCGCTTCTCGGACCTGCCGACCGAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAGAAGAAG
CTGCAAGAGGTCGGCGCCTACGTCGACAAGTGGCTCCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAGCAGGTC
TACGACATGCTGGGCGACCACCTCCCGCGATGGCTCGAGTGCCTGCAGGACATCCGCAAGGTTCGAACCACGTTT
GATACGCAAGAGGTCAGCCGCTCGTTCGGGCACATCACCATCGACTACGACCAGGTGCAGACAAAGGTCAACGCA
AAGTACGATCAGTGGCAGCACGAGATCCTCATCAAGTTCGCCGGAAGACTGGGCAACCGCATGCGCGACGTGCAC
GCCGAAATCGAAAAGGCGCGCAAGCATCTCGAGGGCCAGAGCTCTGACACGTCGTCGACGGCGCAGGCGGTTCAG
TTCATCACGGCCGTGCAGAGCTGCAAGCGCAATGTCAAGCTGTGGGCGCCTGAGATGGACCTCTTTCGTCAGGGG
CAGTCGACGCTGGTGCGCCAGCGATACCACTTCCCGCAGGACTGGCTTCACATCGAGCAGGTCGATAGCCAGTGG
GAGGCGCTCAAGGAGATACTCGACAAGAAGTCGCGCATCATGGAGGAGCAGTCGGATGCGATGAGGGCCAACATT
ACGGCGCAGGACAAGCTGGTCAATGAGCGCATCTGCGAGATCGTCGCGCTGTGGAACGAAGAGAAGCCCGTCTCC
GGGACCATCCAGCCCGATGTGGCCTCGGCCACGCTGGCTTCGTTCGAGTCTCGCATCGCCAGTTTGCAGGAAGAG
TTTCTGCAGGTCGTCAAGGCCAAGGAGGCGCTCGACATCGCCGCCTCGCACGACAGCTCCTTGGAGGCGACGCTC
GAGGAGGTCCGGGACTTTCAGTCGGTCTGGTCCAGCCTCTCGACCATATGGGCGAGCCTCAACGAGACGCGCGAC
ATGCTCTGGACGGCCGTACAGCCGCGCAAGGTGCGCAGCAAGGTCGAGGACCTCATCAAGAGCACCAAGGAGATG
CCCAGTCGCATGAGGCAGTACGCCGCTTTCGAACACGTCCAGGGCATCCTCCGAGGCTTCCTCAAGGTCAACGCC
ATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGGCACTGGCAGAAGATATACAAGCAGATCCGGCCGCAG
AGGCGCTTCTCGCCGAGCTCCATGACGCTGGGCGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCCGTTGTC
AAGGACATCATCGCCCAGGCGCAGGGCGAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACGTGGCAG
AACTACGCGCTCGAGATGGTGAATTACCAGAGCAAGTGTCGCCTCATCCGCGGCTGGGACGAGCTCTTTGCCAAG
TGCAGCGAGAACCTCAACTCGCTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAGGAGGAGGCCGTG
GCGTGGGAGGACAAGCTCAACCGGGTCCACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGCCAATGGGTCTAC
CTCGAGGGCGTATTCACCGGCAATGCCGACATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTCCAGAACATC
AACAGCGAGTTCCTGGCCGTCATGAAGAAGGCCAACAAGACGCCCTACGTGCTGGACGTCCTCAACATCCCCAAC
GCCCAGAAGTCGCTGGAGCGCTTGGCCGAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTGGAGAAG
GAGAGGGTCTCGTTTCCGCGCTTCTACTTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGTAACAGCAACGAC
ACGCTGCGCATCGCCAAGCACTTTAAGAAGATGTTCGCCGGCCTTTCGGGTCTGGTCATGGACGACGAGTCGGTC
ATCACGGGCTTCACCTCCAAGGAAGGGGAGATGGTCAAGCTGAAGAAGGAGATATCCGTGGCCAAGACGCCGAGG
ATCAACGACTGGCTGGCGCTGCTCGAGGGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCCGTGGAT
CGGTACGCGCCCCTGTTCGAGGCCGACGACGACCTGTTGGACGGCGCGCTGAGGCGCTTCATGGACGAGTACCCG
AGTCAGGTGGTGGTTCTGGCCACGCAGGCGGTGTGGACGACGGCGGTCGAGAAGTCGTTGGCCGGAGGCGGCGGT
TCGCTGCCGGCGCTGCTGGAGCGCGAGATGCAGGTCCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTCGAC
GTCATCCTGCGCAAGAAGTGCGAGCAGCTCATCACCGAGTGCGTCCATCAGCGGGACGCCGTCGAGAAGCTCGTC
GAGGCCGGAGCCGACAATGCCGGCCATTACCTGTGGCTGCTCCAGATGCGTTACGTCTACACGCCCGAGGGGGAC
TTCCTCGGCCGGCTGCACGTCAGCATGGCCAATGCCAAGCTCAACTACGGCTTCGAGTACCTGGGCGTCCCGGAC
CGTCTCGTGCGGACGCCCCTGACGGACCGGTGCTTCCTCACCTTGACGCAGGCTCTGTGCCAGCGTCTGGGGGGT
TCGCCGTACGGCCCGGCCGGCACGGGCAAGACGGAGTCGGTCAAGGCTCTCGGCCTTCAGCTCGGCCGCTTCACG
CTCGTCTTCTGCTGCGACGACACGTTCGACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATATGCCAGGTCGGC
GCCTGGGGATGCTTCGACGAGTTCAACCGGCTCGAGGAGAGGATCCTGTCGGCCGTGTCGCAGCAGATTCAGAAT
ATCCAGCTCGGCCTCAGGCAGGGTGCCGAGGACGACGCGTCGTCGCAGATCGAGCTGGTCGGCCGCCAGCTGAGC
GTCAATGAGAACACGGGCATCTTCATCACCATGAACCCGGGCTACGCTGGCCGTTCCAACCTGCCGGACAACCTC
AAGAAGCTCTTTCGCAGCGTGGCCATGTCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCCCAA
GGCTTCAGCCAGGCCAAGCGGCTGTCCAAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCGGGCCGGCTCTCGAAG
CAGGCTCACTACGACTTTGGTCTCCGTGCCCTCAAGAGCGTCCTCGTCAGCTCGGGAGGGCTCAAGCGCGCCCGT
CTCAACGACGGCGGCGAGGACGAGGGCGTGGTGGAGCCGGAAATCATCGTGCAGAGCATCCGCGAGACCATCGCG
CCCAAGCTGATCAAGGCCGACGTGGAGCTCATGACGGGCATCGAAGCCGACTGCTTCCCCGGCGTTCCGTACGTG
CCGGCCAACCTCGGGGACCTGGAGGAGGCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACGGACACG
TGGATGACCAAGATCCTCCAGCTGTACCAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAACTCGGGC
AGCGGCAAGTCGGCCGCCTGGAGGTTGCTGCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTCTTCCAC
GTCATCGACTCCAAGGTCATGTCCAAGGAGGCCCTCTACGGCAACCTGGATCCGACGACGCGCGAGTGGACCGAC
GGCCTGTTCACGAGCATCCTGCGCAAGATTGTGGATAACCTCAGGGGCGAGGACGCCAAGAGGCATTGGATCGTC
TTCGACGGCGACGTCGATCCGGAATGGGTCGAGAACCTCAACAGCGTGCTCGACGACAACAAGCTGCTGACGCTG
CCCAACGGCGAGCGGCTCAGCCTCCCGGCCAACGTCCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCGACG
CTGGCGACGGTCAGTCGCTGCGGCATGGTCTGGTTCAGCGAAGACACGGTGACGCCGGACATGCTGGTGGCGCAC
TATCTCGAGACGCTGGGCAGCGTCCCCTTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGCCAGGCGCCGGCG
CGGATCCTGGCCGTTCAGGCCCGGGTGGCCGACCTGCTGCGGTCGCATCTCTGTGCCGACGACTTCGTGGCCCGG
GTGCTGGCGAGGGCTCAGGAGTACGACCACATCATGGACTTTACCGTCGCCCGCGTCCTCACCACGCTCTTCTCG
CTCCTCAACAAGGCGGTGAGGGACGTGATCGAGTACAATGGCCGGCACGCAGACTTTCCCCTGGACGCGGACCAA
GTCGAGGCCTTTGTGCCCAAGAAGCTGCTGCTGGCGCTGGTGTGGGCTCTGACGGGCGACTGTCCGCTGGCTGAC
CGCAAGGCCTTCGGCGACGACGTCTGTGCCATGGCCAGCTTCGGGTCTCCGCCCCTGGACGGCAGCGGCAGCTCG
CTCATCGATTTCGACGTCAGCCTGCCCAGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCTACCGTCGAGGTC
AACACGCACTCGATCACGCAGACGGACGTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGACGTGCTCTAC
TCGTGGCTGGCAGAGCACAAGCCCTTGCTGCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTCTTCAGT
GCCCTCCGCAAGCTGCCCAACATGGAGGTGGTCGGCCTCAACTTCTCCAGCGCGACGACGCCGGGCCTCCTCATC
AAGACGTTTGAGCAGTATTGCGAGTACAAGAAGACGCTCAACGGCGTGATGCTCTCGCCCACGCAGATCGGTCGT
TGGCTCGTCGTCTTTTGTGACGAGATCAACCTGCCGGCTCCGGACAGGTACGGCACGCAGCGGGCCATCTCGTTC
CTGAGGCAGCTGGTGGAGCACAACGGCTTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGGATCCAG
TTCGTCGGCGCCTGCAACCCGCCCACGGACGCGGGCCGGACGGCGCTCGGGGCTCGCTTCCTCCGGCACGCGCCG
CTCGTCATGGTCGACTACCCGGGCGAGCTCTCGCTCAACCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAG
GTGGTGCCGTCGCTGCGCGGGTACGCCGAGGCGCTGACGCAGGCCATGGTGCGCTTCTACCTCGAGTCGCAGCGG
CGGTTCACGCCCGAGATACAGCCGCATTACGTCTACAGCCCGCGCGAGCTCACGCGCTGGGTCAGGGGCGTGTAC
GAGGCCATCCGGCCGCTCGAGGGGCTGTCGGTCGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTGCGCCTC
TTCCAGGACCGGCTGGTGGACGAGTCGGAGAGGGCGTGGACGGACGAGGCCGTCCGACGCATTGCCTCGGAGCAC
TTCCCCAACGTCGACGAGGAGAAGGCGCTGGGCGGGCCCATCCTGTTCTCCAACTGGTTGTCGCGCAACTACGTG
CCGGTCGAGAGGGAGCGGTTGCGCGAGTTCGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTGGACGTG
CCGCTGATCCTGTTCAACGACGTGCTGGAGCATGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGTCAT
TTGATACTGATTGGCGTCAGCGGCAGCGGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGCCTCAAG
GTGTTTCAGATCAAGGTGCACGGCAAGTACTCGGCCGACGACTTCGACGAGGACCTGCGGGACGTGCTGCGGAGG
TGCGGCTGCAAGGGTGAGAAGATGTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTGGAGCGC
ATGAACACGCTGCTGGCCAACGCCGAGGTCCCCGGCCTGTTCGAGGGCGACGAGTACGCGGCCCTGATGACGGCC
TGCAAGGAGGGGGCGCAGCGGCAGAACCTGCACCTCGACTCTCCCGAAGAGCTGTATCGCTGGTTCACGCAGCAG
ATCGTCAACAACCTGCACGTCGTCTTCACCATGAACCCGCCCGAGGGGGGGCTGTCGTCCAAGGCGGCGACGAGC
CCGGCGCTGTTCAACCGTTGCGTGCTCAACTGGTTCGGCGACTGGTCGGACCAGGCGCTCTTCCAGGTCGGTCAC
GAGCTGACGCAGTCGGTCGACCTGGACCGCGGCGCATACCGGGCTCCCGACTCGATACCGGCGGCGTATCGGGGC
CTGTCGATGCCGCCGACGCACCGCGAGGCCGTGGTCAACTCGATGGTCCACATCCACTACTCGCTGGGGCGGTAC
AACGAGAAGCTGCTCCGGCAGCAGAACAAGCTGACCTTCCTGACGCCGCGGCACTTCCTCGACTTCGTGGGCCAG
TTCGTGCGCTTGTACAACGAGAAGCGGGAGGACCTGGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTCGAGAAG
CTGCGCGACACGGTGGACAAGGTGCGCGATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAGCGCAAG
GACGCCGAGGCCAACGAGAAGCTGCAGCGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGCGGACGACGTCG
CTGGAGATTCAGCAGGCGTTGGAGAAGCAGGAGGCCGAGGTGGCGACGCGGCGACGGGTCGTGCTGGAGGACCTG
GCCAAGGCCGAACCGGCCGTCGAGGAGGCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACGGAGGTG
CGGTCGATGGGCAACCCGCCTCAGGGGGTGAGGCTGGCGCTCGATGCCGTCTGCACGCTGCTGGGCCACCGGATC
GTGGACTGGAAGGCGGTGCAGGCCGTGGTCCGGCGAGACGACTTCATCGCCAGCATCATCATGTTCGACAACGGG
CGGCAGATGACGAGGGCTCTGCGGGCCAAGATGCGCAACGACTTCCTCTCCAACCCGGAGTTTACGTTCGAAAAG
GTCAACAGGGCGTCCAAGGCGTGCGGTCCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCGGACATACTG
GACCGCGTCGGGCCGCTCAAGGACGAGGTCGGCCGGCTGGAGGAACGGGCGCTGCAGACGAAGGCCGAGGCTCGG
GCGGTCGAGGCCAACATCGGCGCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTCATCAGC
GAGACGCAGGCCATCAAGTCGGAGATGGCAAAGGTCCAGTTCAAGGTGGACCGCAGCGTCCGGCTGCTCGACAGC
CTGTCTTCGGAGAGGACCCGATGGGAGGAGGGCAGCCGGTCGTTCGAGACGCAGATCGGCACGCTGGTGGGCGAC
GTGCTGGTGGCGGCCGCCTTCGTGGCCTACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCCATGATGGACGAC
TGGTGCCATCAGCTTCACCTCTCGGGCATCCTGTACAAGTCGCCCAACCCGGTGACGGACTATCTGTCGACGGCG
GACGAGCGGCTGGGCTGGCAGGAGAACACGCTGCCGGCGGACGACCTGTGCACGGAGAACGCCATCATCCTGAAG
CGCTTCAACCGCTATCCCCTCATCATCGATCCGTCGGGGAGGGCGACCGAGTTCCTGCAGCGCGAGTGTCGCGAC
AGGCGGCTGACGGTGACGAGCTTCCTCGACGACGGCTTCACCAAGCAGCTCGAGAGCTCCCTGCGCTTCGGCAAC
CCGATCCTGATACAGGACGCCGAACACCTGGACCCCATCCTCAACCACGTGCTCAACAAGGAGTATCAGCGCACG
GGGGGCCGGGTGCTGATGCAGCTGGGCAAGCAGGAGATTGACTTCTCGCCCTCGTTCCGCCTCTACCTTTCGACG
CGCGATCCGTCGGCCCAGTTCGCGCCCGACATCTGCAGCAGGGCTACCTTTGTCAACTTCACCGTCACAAAGGGC
AGCTTGCGGACGCAGTCGCTCAACGACGTGCTCAAGTCGGAGCGGCCCGACGTCGACGAGCGCCGGACCGACCTC
ATCAAGCTGCAGGGAGAGTTCAAGGTTCACCTACGCCAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAACGAGTCG
CGCGGCAACATCCTCGACGACGACAAGGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCCGCCGACATCTCG
GCCAAGATGAGCAGCACCGAGGGCGTCATGGCCGAGGTGGAGGACATCACGAGACAGTACGGCGTCATCGCCAAC
TCGTGCAGCGCCGTCTTCGCCGTGCTGGATCAGCTGCACTTTCTCAACCACTTCTACCGCTTCTCGCTGCATTAC
TTCCTCGACATCTTCCGCACGGTCCTGCACGGCAACGCCAATCTCGAGGGCGTGGCCGATCACCACGGCCGTCGC
GACATCATCGTCCGCGACCTGTTCGTCAACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGACCGCATA
ACGCTGGCGGTGCTGCTGGCTCAGGCGTCGCCCTACGCCATGGACAGGGGGCTGATGGACGCGGTGCTCGACGGC
GACGTCCGGGGTCGCGACCTGTCGTCGGAGGAGGGGGCGGGCGAGGAGGCGCGTCGAGAGGCCATGACCCGGGCC
GGACGGCTGCCCGCGCTACGGGGCCGGCTGGGGAGGGTGTCGGGCGAGGAGTGGGAGCGCTTCCTCACGGACGAG
CTGGCCGAGGACTGCGTCCCGCGGGGGCTGTTGTCGGGCGGCGGCGGCGGTGACGGAGAAGATGATGAGGGGGCC
GAGGGGGCCGAGGGGGCCGAGGGTGCCGAGATGCGGACGCTGAGCCCCGTCGACGAGGCTCTCCTCTCGCTGCTC
GTCGTCAAGCTGTTCCGGATGGACCGGTTCGTGCCGGCGGCCGAGCGGTTCGTGGGCCGCGTCTTCGGGCCCGAG
ATGCTGGACCACGTCGAGGACCTCGCCGAGACGGTCGGCCAGGTCTCGGCCACGGTCCCCCTCGCGCTCGTGTCC
AGCCCGGGCTTCGACGCCAGCTACAAGGTCGACGGGCTGGTGGAGCGAAAGGGGGTGCGGTGCACCAACATCGCC
ATGGGCTCCAACGAGGGCCTGGCCAGCGCGGACAAGGCCATCAGTCACGCCGCCCAGACGGGATCGTGGGTCCTG
GTCAAGAACGTCCACCTGGCGCCCACCTGGCTGCAGAGCCTGGAGAAGCGGATGGAGGCGCTGAGCCCGCAGGAC
GACTTCCGGCTGTTCCTGTCGATGGAGTCGAGTCCGCGGATCCCGGTGAACCTGATCCGGGCGTCGAGGGTGCTC
ATGTACGAGCAGCCGGCCGGGGTGAGGGCCAACATGAAGGACTCGATGTCTTCGCTCTCGACGAGGGCGGGGAGG
GCGCCGGTCGAGAGGGCGAGGCTTTACCTGTTGATCTGCTTCCTGCACGCCGTCGCGCAGGAGAGGTTGCGGTAC
GCGCCGAGTCTGGGGTGGAAGGGGTTCTGGGAGTTTAACGACAGCGATTATGAGTGCTCGGCTTTCATCATCGAT
ACCTGGCTGGAGAGGACGGCCGGACGGCGAAGCAACATGGCCCCGGCCAACATGCCGTGGGAGATGATGCGGCAT
CTCGTCAGCGAGACGTACGGCGGCAAGATCGACGACGAGGAAGACCTGAAGCTGCTGCGGAAGCTGGTATGGTCT
CTCCTGACGCCGACGGCCTACGACGCGGACCACCAGCTCATGGGCGGGCTCCGGTTGCCGTCGGGGACGAGCGTG
CAGGACTTTATGGGCTGGATCCACGAGTTGCCGGAGAGGGAGCCGCCGACGTATCTGGGGTTGCCGGCGGACGCG
GAGAAGTTGTTGCTGGAGAGAGCGATATTCGCCATGGCTAACTGGCAGCAGTATAACCCCTTCAGCAAGCGCGAA
TCCCATAGCGCGGCCTCCATCACAACCTACAAGATCCTCACCCTCCTAACCTGGATCCTCTCCGTCGTCGTCTCC
ATCTACTACACCGTCCACGCGCCCCACGATGGCTTCACCATCCGTCACCGCATCTGGGACCAGAATTACCTGTAC
CCCAGCGCCTTCACCATGAATCACGTCCTCGCCGACATCTACTGGCTCGTCCTCTTCATCCTTCAGGCCGGTTAC
GTGGCGCACCTCTTCTCCGGCAAGTCCGAGACGGTGTACGCTGCCTCTTCGGTGGGGAGTCACTTCGTGCTGAAC
AACCTGCTGCACTTTGCCTTTGTCATGTTGTTTGTGCGGTCGCATTTTCATTGGGCTGAGGTCATGCTCGTCATC
AACTTTGTCAACCTCAGCTCTCTGTACTTTCGCCATCATGCGCATGGGCGATTCATCCATGGGCCTGCCGTTTCG
GGGCCTTTGGCTTGGACTTTTGTCGCCATTTATTGGAACGGGGCCATCATGGTGCCGCATCAGCATAATCTCGTG
GCCCGCGTGTTTGGCAACATCTTCATCTGGTCCATCCTCGGCTACGGAGCCTTCTTCATCGTTGCTTACAAGGAC
TACACCATGGGCTTCGCGCTCAGCGTCCTGGCTGCGGCCATTGGCGTGGCGCAGTTTGAGAGGCAGGTCGTTGCC
TTGCAGTGGATCTTCGCCTTTGTCATCATGGCGGTTTTGTTCGTCATGACGCTGGTGGTTGCTTTGCCGGCTTGG
GCGGGTAGGGATTTGAGGTGGAGGCGGGCTGAGGCTGATCAGGAGAGGGCGCCTTTGCTGGAGGATTAG
Transcript >Ophcf2|03945
ATGGAGGTATCATCCTCTGCGTCGCCTTCAAATGGCGTCGCGTCGCCGTCTTTCCCGACCATCGAGCCCGAACGC
GTCGTCGATCATCTGGCGGCTGTCTGCGAGATTGCCCTGGGAGCAACGAAGCTTCAGCTCGAACAGCCTGGTAAC
CTGCTGCACAAGAGCCGTTACGCAGAGACGATCTCTCGATGCACACGATTTGCAAACGATGCTCAGAGCGTCCTC
TACGTTCAGAAGGACGTTGCGCCCTCTTCGGCGCCTGAGAATGGTGCCGAGTCTGCTGCCCCCGCCAACTTCCTC
TACACTCTCTCGACTGAGCTGTCTGCATCGGCCTTGACCGTTGCTTCCCTCGTCCTGCTCAAGTCGCCGCAGCCC
ATCGATCCCACCCGTCCGCTCACGTCCCAAATCTTCATCACCAACCTCCCGGGCCCTGCCTCGCTCAACGCCGCT
GTGGGGGAGCACGGCGCAACTCTTTCGCCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTAC
TTCGACGCCAATACCCGCAGTCAGCAGGCGGCGAATGGTGCCAGGGGCCGAACCGAGGTCGACGCCAAGACGGGC
ATCCCCGTCACCAAGAAGAGGCTCAACGACTTGGAGCTCAGCCTGCTTCACCTTCAGCAAAACGTCGACATCCCC
GACATCTCCCTGACCTTTCACTCCATCGTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGGCCTTCG
CTCGACTCTATACCCGCCAACCTGCTGCAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGG
ATCAAGTCCATCCAGGGCATCACCAAGATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCC
AGTCAAGAGGTCAATTTTTGGCTCTCGATGGAGTCCGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGC
GTCCTACTCACACTCGAGATCCTCAAGCACGCCAAGCGTTTTCAGGCCACCGTCAGCTTCACCGCTGACACGGGC
CTCAAGGAGGCCATGGAAAAGGTGCAGAAGTATAACCAGCTGATGCGTGACTTCCCCCTCGACGAGCTCCTCTCC
GCCACGTCGCTGCCCAAGGTCCAGGAGGCTATCGCCCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGC
CCCTACCCCGTCAGGCGGGCCCTTCCCCTGGTCGAGGCCATCTCGGCCGACTTGGACGACGTGCTCCGTCGGCTG
CTGCCGGGCACCGAGCTCGTCGATCTCGATTATCACGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTT
AGGGTGTGGGAGGATAACGTCAAGGAGTTTACCAACGTTGCGCGCGAAGTGACGCGTCGCCGGAACGAAAAGTTC
ATACCCATCAAGATCATCAGGAAGCACTCGGAGCTGGAGTCTCGTATCAAGTACGTCGGCACCTTTCGCGACAAT
CACGAGCAGCTCCAGCGGACCATTGTCAACGTCCTGGGCCCCGGCGTCCAGGCGGCCGGCGGTGGCTCCGACGTC
GCCACGGCCGCCACGGGCACCACAAGCGGCGTCGTCATGGAAGACGTGGGCGGCGTCGACGCCGTCATGGAAGTC
AAGCAGGCCTGGGAAGCGCTGCAGCACGTCGACTTGCTCGACGTTTCCGACCAGGGCAAGGAGCGGTGGGTTCGG
GCTGAGAACCTGTACAACGAGCGGACGACTCGGGTGGAAAACTCGATTATTGCCCGGCTGCGAGACCGGCTCGCG
ACGGCCAAGACGGCCAACGAGATGTTCCGCGTCTTTTCCAAGTTTAACGCGCTCTTTGTGCGGCCCAAGATCAGG
GGCGCCATACAGGAGTATCAGAATCAGTTGATGGACCATGTCAAGCAGGCCATCAACGGCTTGCACGAGCGCTTC
AAGATGCAGTACGGTCACTCTGAGGCTCACGCCATGGCCCAGCTCCGCGACCTGCCCCCCGTCTCGGGAGCCATC
ATCTGGGCGCGCCAGATCGAGTTCCAGCTCGACGGCTACATGAGAAAGGTCGAGGCAGTCCTCGGTCCGGACTGG
CATCTGCACGCCGAGGGACACAAGCTGCGCGAGGAGAGCGACCTGTTCAAGCGCAAGCTCAACACGGCCCGCATC
TTCGAGGCCTGGCTGGCGGACGTCGGCCGGCGCAAGATCTCCATCGCCGGCCAGCTCTTCGACATCGCCCGGGTC
AGGGCCGCCGGCGGTATCCTCGAACTGGCCGTCAACTTTGATCCGCAGGTCATCACGCTCTTCAAGGAGACGAGG
AACCTCGTGTGGCAGTCGTATTCCGTGCCTCACGCCGTCGCCACCGTGTCCAAGGACGCGAAGCGGGTGTATCCC
TACGCCGTCAGCTTGATGGAGAGCGTCAGGACGCTCTCGCAGACGCTGCGGCAGGTTTCCGACATGGGCGAGGAG
TCGATGCTGCTCAACGGCTACCGCAACGAGGTCTACAAGATGATCGGCGAGGGAGTGCCGCTGCGGTGGGAGTCG
TTTATCAACTCGCACGAGCTCTTCTACGCCGACCAGCAGCGTCAGACGCCCCGAGCCCTGATGCCCGCGGCCGGT
GCCGACTTTGGCAGCGTCGCCAAGGGCACGGAGAGCAAGCACGGCATGTTCATCCGGAGCTTCGCCGCCGCCGTC
TCCGTCCTCCAGGCCAAGGCCACGTCTCTGATGCACATTCACGCCACGGTCGAGCAGGCGCTCAGGGAGCTGGGC
ACCTGTCCCTACGATGCCTCGGCCTTCCAGCCGCGCCTCAGCACCATCCAGGCCGCCGTCGACCAGCTGAACCTG
GAGCAGTACGTCAACCTCGACTACTGGGTGCGCGGCCTGAACCAGAAGATCCAGTCCATCCTGCTCGGCCGCCTG
CACGCCGCCATCCAGGCCTGGATCTCCGCCTTCGAGGAAGACACGCCGGACGATGGGGGCCGCCGAGCGAAGACG
GCGGGTGGCGACGACGACGACGACAGGCAGCACGGCCCGGCCATGAAGCGTCTGGTGCTCGAGCTGGCCATGCGG
AACCAGGTCATCTACCTGGACCCTGCCCTGGAGCACGCCCGGGCCAGCTGGTTTCTCCTGCTCCACGACTGGATC
GGCATCGTCTGTGACCTTCGCAAGATCAAGGCGACCAGGTATCAGATGAGCATCACAACCAGCGCCGCCGCCGAC
GAGCCGCGCTTCTCGGACCTGCCGACCGAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAGAAGAAG
CTGCAAGAGGTCGGCGCCTACGTCGACAAGTGGCTCCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAGCAGGTC
TACGACATGCTGGGCGACCACCTCCCGCGATGGCTCGAGTGCCTGCAGGACATCCGCAAGGTTCGAACCACGTTT
GATACGCAAGAGGTCAGCCGCTCGTTCGGGCACATCACCATCGACTACGACCAGGTGCAGACAAAGGTCAACGCA
AAGTACGATCAGTGGCAGCACGAGATCCTCATCAAGTTCGCCGGAAGACTGGGCAACCGCATGCGCGACGTGCAC
GCCGAAATCGAAAAGGCGCGCAAGCATCTCGAGGGCCAGAGCTCTGACACGTCGTCGACGGCGCAGGCGGTTCAG
TTCATCACGGCCGTGCAGAGCTGCAAGCGCAATGTCAAGCTGTGGGCGCCTGAGATGGACCTCTTTCGTCAGGGG
CAGTCGACGCTGGTGCGCCAGCGATACCACTTCCCGCAGGACTGGCTTCACATCGAGCAGGTCGATAGCCAGTGG
GAGGCGCTCAAGGAGATACTCGACAAGAAGTCGCGCATCATGGAGGAGCAGTCGGATGCGATGAGGGCCAACATT
ACGGCGCAGGACAAGCTGGTCAATGAGCGCATCTGCGAGATCGTCGCGCTGTGGAACGAAGAGAAGCCCGTCTCC
GGGACCATCCAGCCCGATGTGGCCTCGGCCACGCTGGCTTCGTTCGAGTCTCGCATCGCCAGTTTGCAGGAAGAG
TTTCTGCAGGTCGTCAAGGCCAAGGAGGCGCTCGACATCGCCGCCTCGCACGACAGCTCCTTGGAGGCGACGCTC
GAGGAGGTCCGGGACTTTCAGTCGGTCTGGTCCAGCCTCTCGACCATATGGGCGAGCCTCAACGAGACGCGCGAC
ATGCTCTGGACGGCCGTACAGCCGCGCAAGGTGCGCAGCAAGGTCGAGGACCTCATCAAGAGCACCAAGGAGATG
CCCAGTCGCATGAGGCAGTACGCCGCTTTCGAACACGTCCAGGGCATCCTCCGAGGCTTCCTCAAGGTCAACGCC
ATCCTGTCGGACCTCAAGTCGGACGCGATCCGCGAGCGGCACTGGCAGAAGATATACAAGCAGATCCGGCCGCAG
AGGCGCTTCTCGCCGAGCTCCATGACGCTGGGCGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCCGTTGTC
AAGGACATCATCGCCCAGGCGCAGGGCGAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACGTGGCAG
AACTACGCGCTCGAGATGGTGAATTACCAGAGCAAGTGTCGCCTCATCCGCGGCTGGGACGAGCTCTTTGCCAAG
TGCAGCGAGAACCTCAACTCGCTGCAGGCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAGGAGGAGGCCGTG
GCGTGGGAGGACAAGCTCAACCGGGTCCACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGCCAATGGGTCTAC
CTCGAGGGCGTATTCACCGGCAATGCCGACATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTCCAGAACATC
AACAGCGAGTTCCTGGCCGTCATGAAGAAGGCCAACAAGACGCCCTACGTGCTGGACGTCCTCAACATCCCCAAC
GCCCAGAAGTCGCTGGAGCGCTTGGCCGAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTGGAGAAG
GAGAGGGTCTCGTTTCCGCGCTTCTACTTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGTAACAGCAACGAC
ACGCTGCGCATCGCCAAGCACTTTAAGAAGATGTTCGCCGGCCTTTCGGGTCTGGTCATGGACGACGAGTCGGTC
ATCACGGGCTTCACCTCCAAGGAAGGGGAGATGGTCAAGCTGAAGAAGGAGATATCCGTGGCCAAGACGCCGAGG
ATCAACGACTGGCTGGCGCTGCTCGAGGGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCCGTGGAT
CGGTACGCGCCCCTGTTCGAGGCCGACGACGACCTGTTGGACGGCGCGCTGAGGCGCTTCATGGACGAGTACCCG
AGTCAGGTGGTGGTTCTGGCCACGCAGGCGGTGTGGACGACGGCGGTCGAGAAGTCGTTGGCCGGAGGCGGCGGT
TCGCTGCCGGCGCTGCTGGAGCGCGAGATGCAGGTCCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTCGAC
GTCATCCTGCGCAAGAAGTGCGAGCAGCTCATCACCGAGTGCGTCCATCAGCGGGACGCCGTCGAGAAGCTCGTC
GAGGCCGGAGCCGACAATGCCGGCCATTACCTGTGGCTGCTCCAGATGCGTTACGTCTACACGCCCGAGGGGGAC
TTCCTCGGCCGGCTGCACGTCAGCATGGCCAATGCCAAGCTCAACTACGGCTTCGAGTACCTGGGCGTCCCGGAC
CGTCTCGTGCGGACGCCCCTGACGGACCGGTGCTTCCTCACCTTGACGCAGGCTCTGTGCCAGCGTCTGGGGGGT
TCGCCGTACGGCCCGGCCGGCACGGGCAAGACGGAGTCGGTCAAGGCTCTCGGCCTTCAGCTCGGCCGCTTCACG
CTCGTCTTCTGCTGCGACGACACGTTCGACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATATGCCAGGTCGGC
GCCTGGGGATGCTTCGACGAGTTCAACCGGCTCGAGGAGAGGATCCTGTCGGCCGTGTCGCAGCAGATTCAGAAT
ATCCAGCTCGGCCTCAGGCAGGGTGCCGAGGACGACGCGTCGTCGCAGATCGAGCTGGTCGGCCGCCAGCTGAGC
GTCAATGAGAACACGGGCATCTTCATCACCATGAACCCGGGCTACGCTGGCCGTTCCAACCTGCCGGACAACCTC
AAGAAGCTCTTTCGCAGCGTGGCCATGTCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCCCAA
GGCTTCAGCCAGGCCAAGCGGCTGTCCAAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCGGGCCGGCTCTCGAAG
CAGGCTCACTACGACTTTGGTCTCCGTGCCCTCAAGAGCGTCCTCGTCAGCTCGGGAGGGCTCAAGCGCGCCCGT
CTCAACGACGGCGGCGAGGACGAGGGCGTGGTGGAGCCGGAAATCATCGTGCAGAGCATCCGCGAGACCATCGCG
CCCAAGCTGATCAAGGCCGACGTGGAGCTCATGACGGGCATCGAAGCCGACTGCTTCCCCGGCGTTCCGTACGTG
CCGGCCAACCTCGGGGACCTGGAGGAGGCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACGGACACG
TGGATGACCAAGATCCTCCAGCTGTACCAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAACTCGGGC
AGCGGCAAGTCGGCCGCCTGGAGGTTGCTGCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTCTTCCAC
GTCATCGACTCCAAGGTCATGTCCAAGGAGGCCCTCTACGGCAACCTGGATCCGACGACGCGCGAGTGGACCGAC
GGCCTGTTCACGAGCATCCTGCGCAAGATTGTGGATAACCTCAGGGGCGAGGACGCCAAGAGGCATTGGATCGTC
TTCGACGGCGACGTCGATCCGGAATGGGTCGAGAACCTCAACAGCGTGCTCGACGACAACAAGCTGCTGACGCTG
CCCAACGGCGAGCGGCTCAGCCTCCCGGCCAACGTCCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCGACG
CTGGCGACGGTCAGTCGCTGCGGCATGGTCTGGTTCAGCGAAGACACGGTGACGCCGGACATGCTGGTGGCGCAC
TATCTCGAGACGCTGGGCAGCGTCCCCTTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGCCAGGCGCCGGCG
CGGATCCTGGCCGTTCAGGCCCGGGTGGCCGACCTGCTGCGGTCGCATCTCTGTGCCGACGACTTCGTGGCCCGG
GTGCTGGCGAGGGCTCAGGAGTACGACCACATCATGGACTTTACCGTCGCCCGCGTCCTCACCACGCTCTTCTCG
CTCCTCAACAAGGCGGTGAGGGACGTGATCGAGTACAATGGCCGGCACGCAGACTTTCCCCTGGACGCGGACCAA
GTCGAGGCCTTTGTGCCCAAGAAGCTGCTGCTGGCGCTGGTGTGGGCTCTGACGGGCGACTGTCCGCTGGCTGAC
CGCAAGGCCTTCGGCGACGACGTCTGTGCCATGGCCAGCTTCGGGTCTCCGCCCCTGGACGGCAGCGGCAGCTCG
CTCATCGATTTCGACGTCAGCCTGCCCAGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCTACCGTCGAGGTC
AACACGCACTCGATCACGCAGACGGACGTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGACGTGCTCTAC
TCGTGGCTGGCAGAGCACAAGCCCTTGCTGCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTCTTCAGT
GCCCTCCGCAAGCTGCCCAACATGGAGGTGGTCGGCCTCAACTTCTCCAGCGCGACGACGCCGGGCCTCCTCATC
AAGACGTTTGAGCAGTATTGCGAGTACAAGAAGACGCTCAACGGCGTGATGCTCTCGCCCACGCAGATCGGTCGT
TGGCTCGTCGTCTTTTGTGACGAGATCAACCTGCCGGCTCCGGACAGGTACGGCACGCAGCGGGCCATCTCGTTC
CTGAGGCAGCTGGTGGAGCACAACGGCTTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGGATCCAG
TTCGTCGGCGCCTGCAACCCGCCCACGGACGCGGGCCGGACGGCGCTCGGGGCTCGCTTCCTCCGGCACGCGCCG
CTCGTCATGGTCGACTACCCGGGCGAGCTCTCGCTCAACCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAG
GTGGTGCCGTCGCTGCGCGGGTACGCCGAGGCGCTGACGCAGGCCATGGTGCGCTTCTACCTCGAGTCGCAGCGG
CGGTTCACGCCCGAGATACAGCCGCATTACGTCTACAGCCCGCGCGAGCTCACGCGCTGGGTCAGGGGCGTGTAC
GAGGCCATCCGGCCGCTCGAGGGGCTGTCGGTCGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTGCGCCTC
TTCCAGGACCGGCTGGTGGACGAGTCGGAGAGGGCGTGGACGGACGAGGCCGTCCGACGCATTGCCTCGGAGCAC
TTCCCCAACGTCGACGAGGAGAAGGCGCTGGGCGGGCCCATCCTGTTCTCCAACTGGTTGTCGCGCAACTACGTG
CCGGTCGAGAGGGAGCGGTTGCGCGAGTTCGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTGGACGTG
CCGCTGATCCTGTTCAACGACGTGCTGGAGCATGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGTCAT
TTGATACTGATTGGCGTCAGCGGCAGCGGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGCCTCAAG
GTGTTTCAGATCAAGGTGCACGGCAAGTACTCGGCCGACGACTTCGACGAGGACCTGCGGGACGTGCTGCGGAGG
TGCGGCTGCAAGGGTGAGAAGATGTGCTTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTGGAGCGC
ATGAACACGCTGCTGGCCAACGCCGAGGTCCCCGGCCTGTTCGAGGGCGACGAGTACGCGGCCCTGATGACGGCC
TGCAAGGAGGGGGCGCAGCGGCAGAACCTGCACCTCGACTCTCCCGAAGAGCTGTATCGCTGGTTCACGCAGCAG
ATCGTCAACAACCTGCACGTCGTCTTCACCATGAACCCGCCCGAGGGGGGGCTGTCGTCCAAGGCGGCGACGAGC
CCGGCGCTGTTCAACCGTTGCGTGCTCAACTGGTTCGGCGACTGGTCGGACCAGGCGCTCTTCCAGGTCGGTCAC
GAGCTGACGCAGTCGGTCGACCTGGACCGCGGCGCATACCGGGCTCCCGACTCGATACCGGCGGCGTATCGGGGC
CTGTCGATGCCGCCGACGCACCGCGAGGCCGTGGTCAACTCGATGGTCCACATCCACTACTCGCTGGGGCGGTAC
AACGAGAAGCTGCTCCGGCAGCAGAACAAGCTGACCTTCCTGACGCCGCGGCACTTCCTCGACTTCGTGGGCCAG
TTCGTGCGCTTGTACAACGAGAAGCGGGAGGACCTGGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTCGAGAAG
CTGCGCGACACGGTGGACAAGGTGCGCGATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAGCGCAAG
GACGCCGAGGCCAACGAGAAGCTGCAGCGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGCGGACGACGTCG
CTGGAGATTCAGCAGGCGTTGGAGAAGCAGGAGGCCGAGGTGGCGACGCGGCGACGGGTCGTGCTGGAGGACCTG
GCCAAGGCCGAACCGGCCGTCGAGGAGGCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACGGAGGTG
CGGTCGATGGGCAACCCGCCTCAGGGGGTGAGGCTGGCGCTCGATGCCGTCTGCACGCTGCTGGGCCACCGGATC
GTGGACTGGAAGGCGGTGCAGGCCGTGGTCCGGCGAGACGACTTCATCGCCAGCATCATCATGTTCGACAACGGG
CGGCAGATGACGAGGGCTCTGCGGGCCAAGATGCGCAACGACTTCCTCTCCAACCCGGAGTTTACGTTCGAAAAG
GTCAACAGGGCGTCCAAGGCGTGCGGTCCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCGGACATACTG
GACCGCGTCGGGCCGCTCAAGGACGAGGTCGGCCGGCTGGAGGAACGGGCGCTGCAGACGAAGGCCGAGGCTCGG
GCGGTCGAGGCCAACATCGGCGCGCTCGAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTCATCAGC
GAGACGCAGGCCATCAAGTCGGAGATGGCAAAGGTCCAGTTCAAGGTGGACCGCAGCGTCCGGCTGCTCGACAGC
CTGTCTTCGGAGAGGACCCGATGGGAGGAGGGCAGCCGGTCGTTCGAGACGCAGATCGGCACGCTGGTGGGCGAC
GTGCTGGTGGCGGCCGCCTTCGTGGCCTACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCCATGATGGACGAC
TGGTGCCATCAGCTTCACCTCTCGGGCATCCTGTACAAGTCGCCCAACCCGGTGACGGACTATCTGTCGACGGCG
GACGAGCGGCTGGGCTGGCAGGAGAACACGCTGCCGGCGGACGACCTGTGCACGGAGAACGCCATCATCCTGAAG
CGCTTCAACCGCTATCCCCTCATCATCGATCCGTCGGGGAGGGCGACCGAGTTCCTGCAGCGCGAGTGTCGCGAC
AGGCGGCTGACGGTGACGAGCTTCCTCGACGACGGCTTCACCAAGCAGCTCGAGAGCTCCCTGCGCTTCGGCAAC
CCGATCCTGATACAGGACGCCGAACACCTGGACCCCATCCTCAACCACGTGCTCAACAAGGAGTATCAGCGCACG
GGGGGCCGGGTGCTGATGCAGCTGGGCAAGCAGGAGATTGACTTCTCGCCCTCGTTCCGCCTCTACCTTTCGACG
CGCGATCCGTCGGCCCAGTTCGCGCCCGACATCTGCAGCAGGGCTACCTTTGTCAACTTCACCGTCACAAAGGGC
AGCTTGCGGACGCAGTCGCTCAACGACGTGCTCAAGTCGGAGCGGCCCGACGTCGACGAGCGCCGGACCGACCTC
ATCAAGCTGCAGGGAGAGTTCAAGGTTCACCTACGCCAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAACGAGTCG
CGCGGCAACATCCTCGACGACGACAAGGTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCCGCCGACATCTCG
GCCAAGATGAGCAGCACCGAGGGCGTCATGGCCGAGGTGGAGGACATCACGAGACAGTACGGCGTCATCGCCAAC
TCGTGCAGCGCCGTCTTCGCCGTGCTGGATCAGCTGCACTTTCTCAACCACTTCTACCGCTTCTCGCTGCATTAC
TTCCTCGACATCTTCCGCACGGTCCTGCACGGCAACGCCAATCTCGAGGGCGTGGCCGATCACCACGGCCGTCGC
GACATCATCGTCCGCGACCTGTTCGTCAACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGACCGCATA
ACGCTGGCGGTGCTGCTGGCTCAGGCGTCGCCCTACGCCATGGACAGGGGGCTGATGGACGCGGTGCTCGACGGC
GACGTCCGGGGTCGCGACCTGTCGTCGGAGGAGGGGGCGGGCGAGGAGGCGCGTCGAGAGGCCATGACCCGGGCC
GGACGGCTGCCCGCGCTACGGGGCCGGCTGGGGAGGGTGTCGGGCGAGGAGTGGGAGCGCTTCCTCACGGACGAG
CTGGCCGAGGACTGCGTCCCGCGGGGGCTGTTGTCGGGCGGCGGCGGCGGTGACGGAGAAGATGATGAGGGGGCC
GAGGGGGCCGAGGGGGCCGAGGGTGCCGAGATGCGGACGCTGAGCCCCGTCGACGAGGCTCTCCTCTCGCTGCTC
GTCGTCAAGCTGTTCCGGATGGACCGGTTCGTGCCGGCGGCCGAGCGGTTCGTGGGCCGCGTCTTCGGGCCCGAG
ATGCTGGACCACGTCGAGGACCTCGCCGAGACGGTCGGCCAGGTCTCGGCCACGGTCCCCCTCGCGCTCGTGTCC
AGCCCGGGCTTCGACGCCAGCTACAAGGTCGACGGGCTGGTGGAGCGAAAGGGGGTGCGGTGCACCAACATCGCC
ATGGGCTCCAACGAGGGCCTGGCCAGCGCGGACAAGGCCATCAGTCACGCCGCCCAGACGGGATCGTGGGTCCTG
GTCAAGAACGTCCACCTGGCGCCCACCTGGCTGCAGAGCCTGGAGAAGCGGATGGAGGCGCTGAGCCCGCAGGAC
GACTTCCGGCTGTTCCTGTCGATGGAGTCGAGTCCGCGGATCCCGGTGAACCTGATCCGGGCGTCGAGGGTGCTC
ATGTACGAGCAGCCGGCCGGGGTGAGGGCCAACATGAAGGACTCGATGTCTTCGCTCTCGACGAGGGCGGGGAGG
GCGCCGGTCGAGAGGGCGAGGCTTTACCTGTTGATCTGCTTCCTGCACGCCGTCGCGCAGGAGAGGTTGCGGTAC
GCGCCGAGTCTGGGGTGGAAGGGGTTCTGGGAGTTTAACGACAGCGATTATGAGTGCTCGGCTTTCATCATCGAT
ACCTGGCTGGAGAGGACGGCCGGACGGCGAAGCAACATGGCCCCGGCCAACATGCCGTGGGAGATGATGCGGCAT
CTCGTCAGCGAGACGTACGGCGGCAAGATCGACGACGAGGAAGACCTGAAGCTGCTGCGGAAGCTGGTATGGTCT
CTCCTGACGCCGACGGCCTACGACGCGGACCACCAGCTCATGGGCGGGCTCCGGTTGCCGTCGGGGACGAGCGTG
CAGGACTTTATGGGCTGGATCCACGAGTTGCCGGAGAGGGAGCCGCCGACGTATCTGGGGTTGCCGGCGGACGCG
GAGAAGTTGTTGCTGGAGAGAGCGATATTCGCCATGGCTAACTGGCAGCAGTATAACCCCTTCAGCAAGCGCGAA
TCCCATAGCGCGGCCTCCATCACAACCTACAAGATCCTCACCCTCCTAACCTGGATCCTCTCCGTCGTCGTCTCC
ATCTACTACACCGTCCACGCGCCCCACGATGGCTTCACCATCCGTCACCGCATCTGGGACCAGAATTACCTGTAC
CCCAGCGCCTTCACCATGAATCACGTCCTCGCCGACATCTACTGGCTCGTCCTCTTCATCCTTCAGGCCGGTTAC
GTGGCGCACCTCTTCTCCGGCAAGTCCGAGACGGTGTACGCTGCCTCTTCGGTGGGGAGTCACTTCGTGCTGAAC
AACCTGCTGCACTTTGCCTTTGTCATGTTGTTTGTGCGGTCGCATTTTCATTGGGCTGAGGTCATGCTCGTCATC
AACTTTGTCAACCTCAGCTCTCTGTACTTTCGCCATCATGCGCATGGGCGATTCATCCATGGGCCTGCCGTTTCG
GGGCCTTTGGCTTGGACTTTTGTCGCCATTTATTGGAACGGGGCCATCATGGTGCCGCATCAGCATAATCTCGTG
GCCCGCGTGTTTGGCAACATCTTCATCTGGTCCATCCTCGGCTACGGAGCCTTCTTCATCGTTGCTTACAAGGAC
TACACCATGGGCTTCGCGCTCAGCGTCCTGGCTGCGGCCATTGGCGTGGCGCAGTTTGAGAGGCAGGTCGTTGCC
TTGCAGTGGATCTTCGCCTTTGTCATCATGGCGGTTTTGTTCGTCATGACGCTGGTGGTTGCTTTGCCGGCTTGG
GCGGGTAGGGATTTGAGGTGGAGGCGGGCTGAGGCTGATCAGGAGAGGGCGCCTTTGCTGGAGGATTAG
Gene >Ophcf2|03945
ATGGAGGTATCATCCTCTGCGTCGCCTTCAAATGGCGTCGCGTCGCCGTCTTTCCCGACCATCGAGCCCGAACGC
GTCGTCGATCATCTGGCGGCTGTCTGCGAGATTGCCCTGGGAGCAACGAAGCTTCAGCTCGAACAGCCTGGTAAC
CTGCTGCACAAGAGCCGTTACGCAGAGACGATCTCTCGATGCACACGATTTGCAAACGATGCTCAGAGCGTCCTC
TACGTTCAGAAGGACGTTGCGCCCTCTTCGGCGCCTGAGAATGGTGCCGAGTCTGCTGGTGAGTCCCTCCCTCCC
TCTTCTTAACTCGTCGCTGAACGCCTCTTAGCCCCCGCCAACTTCCTCTACACTCTCTCGACTGAGCTGTCTGCA
TCGGCCTTGACCGTTGCTTCCCTCGTCCTGCTCAAGTCGCCGCAGCCCATCGATCCCACCCGTCCGCTCACGTCC
CAAATCTTCATCACCAACCTCCCGGGCCCTGCCTCGCTCAACGCCGCTGTGGGGGAGCACGGCGCAACTCTTTCG
CCGTGGGAGGTGCTGCACTCGCAGGTTCACCACGCCTTGGTGCCCTACTTCGACGCCAATACCCGCAGTCAGCAG
GCGGCGAATGGTGCCAGGGGCCGAACCGAGGTCGACGCCAAGACGGGCATCCCCGTCACCAAGAAGAGGCTCAAC
GACTTGGAGCTCAGCCTGCTTCACCTTCAGCAAAACGTCGACATCCCCGACATCTCCCTGACCTTTCACTCCATC
GTCCAAAACGTCGTCGAAGAGGCCGAGGCCCGCCACACGAGGCCTTCGCTCGACTCTATACCCGCCAACCTGCTG
CAGGATAGCACCTTTCTCAACCGGCTGCAGGCCAACGTCAATACGTGGATCAAGTCCATCCAGGGCATCACCAAG
ATGACCAAAGACCCGTCGCCGGGAGCGAATCAGGAGTTCAGCACCGCCAGTCAAGAGGTCAATTTTTGGCTCTCG
ATGGAGTCCGCGCTCGAGAGCATCGAGGGCCAGCTGAGGAGCGAAGGCGTCCTACTCACACTCGAGATCCTCAAG
CACGCCAAGCGTTTTCAGGCCACCGTCAGCTTCACCGCTGACACGGGCCTCAAGGAGGCCATGGAAAAGGTGCAG
AAGTATAACCAGCTGATGCGTGACTTCCCCCTCGACGAGCTCCTCTCCGCCACGTCGCTGCCCAAGGTCCAGGAG
GCTATCGCCCAGATCTTTGGCCATCTCAACAAGAAGCTCAGGATATGCCCCTACCCCGTCAGGCGGGCCCTTCCC
CTGGTCGAGGCCATCTCGGCCGACTTGGACGACGTGCTCCGTCGGCTGCTGCCGGGCACCGAGCTCGTCGATCTC
GATTATCACGAGTTTCAGGCTCTGATGCGCACCTGCGATGGCATCTTTAGGGTGTGGGAGGATAACGTCAAGGAG
TTTACCAACGTTGCGCGCGAAGTGACGCGTCGCCGGAACGAAAAGTTCATACCCATCAAGATCATCAGGAAGCAC
TCGGAGCTGGAGTCTCGTATCAAGTACGTCGGCACCTTTCGCGACAATCACGAGCAGCTCCAGCGGACCATTGTC
AACGTCCTGGGCCCCGGCGTCCAGGCGGCCGGCGGTGGCTCCGACGTCGCCACGGCCGCCACGGGCACCACAAGC
GGCGTCGTCATGGAAGACGTGGGCGGCGTCGACGCCGTCATGGAAGTCAAGCAGGCCTGGGAAGCGCTGCAGCAC
GTCGACTTGCTCGACGTTTCCGACCAGGGCAAGGAGCGGTGGGTTCGGGCTGAGAACCTGTACAACGAGCGGACG
ACTCGGGTGGAAAACTCGATTATTGCCCGGCTGCGAGACCGGCTCGCGACGGCCAAGACGGCCAACGAGATGTTC
CGCGTCTTTTCCAAGTTTAACGCGCTCTTTGTGCGGCCCAAGATCAGGGGCGCCATACAGGAGTATCAGAATCAG
TTGATGGACCATGTCAAGCAGGCCATCAACGGCTTGCACGAGCGCTTCAAGATGCAGTACGGTCACTCTGAGGCT
CACGCCATGGCCCAGCTCCGCGACCTGCCCCCCGTCTCGGGAGCCATCATCTGGGCGCGCCAGATCGAGTTCCAG
CTCGACGGCTACATGAGAAAGGTCGAGGCAGTCCTCGGTCCGGACTGGCATCTGCACGCCGAGGGACACAAGCTG
CGCGAGGAGAGCGACCTGTTCAAGCGCAAGCTCAACACGGCCCGCATCTTCGAGGCCTGGCTGGCGGACGTCGGC
CGGCGCAAGATCTCCATCGCCGGCCAGCTCTTCGACATCGCCCGGGTCAGGGCCGCCGGCGGTATCCTCGAACTG
GCCGTCAACTTTGATCCGCAGGTCATCACGCTCTTCAAGGAGACGAGGAACCTCGTGTGGCAGTCGTATTCCGTG
CCTCACGCCGTCGCCACCGTGTCCAAGGACGCGAAGCGGGTGTATCCCTACGCCGTCAGCTTGATGGAGAGCGTC
AGGACGCTCTCGCAGACGCTGCGGCAGGTTTCCGACATGGGCGAGGAGTCGATGCTGCTCAACGGCTACCGCAAC
GAGGTCTACAAGATGATCGGCGAGGGAGTGCCGCTGCGGTGGGAGTCGTTTATCAACTCGCACGAGCTCTTCTAC
GCCGACCAGCAGCGTCAGACGCCCCGAGCCCTGATGCCCGCGGCCGGTGCCGACTTTGGCAGCGTCGCCAAGGGC
ACGGAGAGCAAGCACGGCATGTTCATCCGGAGCTTCGCCGCCGCCGTCTCCGTCCTCCAGGCCAAGGCCACGTCT
CTGATGCACATTCACGCCACGGTCGAGCAGGCGCTCAGGGAGCTGGGCACCTGTCCCTACGATGCCTCGGCCTTC
CAGCCGCGCCTCAGCACCATCCAGGCCGCCGTCGACCAGCTGAACCTGGAGCAGTACGTCAACCTCGACTACTGG
GTGCGCGGCCTGAACCAGAAGATCCAGTCCATCCTGCTCGGCCGCCTGCACGCCGCCATCCAGGCCTGGATCTCC
GCCTTCGAGGAAGACACGCCGGACGATGGGGGCCGCCGAGCGAAGACGGCGGGTGGCGACGACGACGACGACAGG
CAGCACGGCCCGGCCATGAAGCGTCTGGTGCTCGAGCTGGCCATGCGGAACCAGGTCATCTACCTGGACCCTGCC
CTGGAGCACGCCCGGGCCAGCTGGTTTCTCCTGCTCCACGACTGGATCGGCATCGTCTGTGACCTTCGCAAGATC
AAGGCGACCAGGTATCAGATGAGCATCACAACCAGCGCCGCCGCCGACGAGCCGCGCTTCTCGGACCTGCCGACC
GAGTGCGCCGGCATGCTGCATCGGGTGTACGTCTCGGTCGAGAAGAAGCTGCAAGAGGTCGGCGCCTACGTCGAC
AAGTGGCTCCAGTTCCAGTCCCTGTGGGATCTTCAGTCGGAGCAGGTCTACGACATGCTGGGCGACCACCTCCCG
CGATGGCTCGAGTGCCTGCAGGACATCCGCAAGGTTCGAACCACGTTTGATACGCAAGAGGTCAGCCGCTCGTTC
GGGCACATCACCATCGACTACGACCAGGTGCAGACAAAGGTCAACGCAAAGTACGATCAGTGGCAGCACGAGATC
CTCATCAAGTTCGCCGGAAGACTGGGCAACCGCATGCGCGACGTGCACGCCGAAATCGAAAAGGCGCGCAAGCAT
CTCGAGGGCCAGAGCTCTGACACGTCGTCGACGGCGCAGGCGGTTCAGTTCATCACGGCCGTGCAGAGCTGCAAG
CGCAATGTCAAGCTGTGGGCGCCTGAGATGGACCTCTTTCGTCAGGGGCAGTCGACGCTGGTGCGCCAGCGATAC
CACTTCCCGCAGGACTGGCTTCACATCGAGCAGGTCGATAGCCAGTGGGAGGCGCTCAAGGAGATACTCGACAAG
AAGTCGCGCATCATGGAGGAGCAGTCGGATGCGATGAGGGCCAACATTACGGCGCAGGACAAGCTGGTCAATGAG
CGCATCTGCGAGATCGTCGCGCTGTGGAACGAAGAGAAGCCCGTCTCCGGGACCATCCAGCCCGATGTGGCCTCG
GCCACGCTGGCTTCGTTCGAGTCTCGCATCGCCAGTTTGCAGGAAGAGTTTCTGCAGGTCGTCAAGGCCAAGGAG
GCGCTCGACATCGCCGCCTCGCACGACAGCTCCTTGGAGGCGACGCTCGAGGAGGTCCGGGACTTTCAGTCGGTC
TGGTCCAGCCTCTCGACCATATGGGCGAGCCTCAACGAGACGCGCGACATGCTCTGGACGGCCGTACAGCCGCGC
AAGGTGCGCAGCAAGGTCGAGGACCTCATCAAGAGCACCAAGGAGATGCCCAGTCGCATGAGGCAGTACGCCGCT
TTCGAACACGTCCAGGGCATCCTCCGAGGCTTCCTCAAGGTCAACGCCATCCTGTCGGACCTCAAGTCGGACGCG
ATCCGCGAGCGGCACTGGCAGAAGATATACAAGCAGATCCGGCCGCAGAGGCGCTTCTCGCCGAGCTCCATGACG
CTGGGCGACGTGTGGGATCTGAACCTGGTGGCGACCGAGGCCGTTGTCAAGGACATCATCGCCCAGGCGCAGGGC
GAGATGGCGCTCGAGGAGTTCTTGAAGCAGGTGCGCGAGACGTGGCAGAACTACGCGCTCGAGATGGTGAATTAC
CAGAGCAAGTGTCGCCTCATCCGCGGCTGGGACGAGCTCTTTGCCAAGTGCAGCGAGAACCTCAACTCGCTGCAG
GCCATGAAGCACTCGCCCTACTACAAGGAGTTCGAGGAGGAGGCCGTGGCGTGGGAGGACAAGCTCAACCGGGTC
CACGTCCTGTTCGACGTCTGGATCGACGTCCAGCGCCAATGGGTCTACCTCGAGGGCGTATTCACCGGCAATGCC
GACATCAAGCACCTGCTGCCCATCGAGTCGGGTCGCTTCCAGAACATCAACAGCGAGTTCCTGGCCGTCATGAAG
AAGGCCAACAAGACGCCCTACGTGCTGGACGTCCTCAACATCCCCAACGCCCAGAAGTCGCTGGAGCGCTTGGCC
GAGATGCTCAACAAGATTCAAAAGGCGCTGGGCGAGTACCTGGAGAAGGAGAGGGTCTCGTTTCCGCGCTTCTAC
TTCGTCGGCGACGAGGACCTGCTGGAGATGATCGGTAACAGCAACGACACGCTGCGCATCGCCAAGCACTTTAAG
AAGATGTTCGCCGGCCTTTCGGGTCTGGTCATGGACGACGAGTCGGTCATCACGGGCTTCACCTCCAAGGAAGGG
GAGATGGTCAAGCTGAAGAAGGAGATATCCGTGGCCAAGACGCCGAGGATCAACGACTGGCTGGCGCTGCTCGAG
GGCGGCATGAAGTCGACGCTGGCCGAGCTGCTGGCCGAGGCCGTGGATCGGTACGCGCCCCTGTTCGAGGCCGAC
GACGACCTGTTGGACGGCGCGCTGAGGCGCTTCATGGACGAGTACCCGAGTCAGGTGGTGGTTCTGGCCACGCAG
GCGGTGTGGACGACGGCGGTCGAGAAGTCGTTGGCCGGAGGCGGCGGTTCGCTGCCGGCGCTGCTGGAGCGCGAG
ATGCAGGTCCTCGGCGTCCTGGCCGACACCGTCCTGGGCGATCTCGACGTCATCCTGCGCAAGAAGTGCGAGCAG
CTCATCACCGAGTGCGTCCATCAGCGGGACGCCGTCGAGAAGCTCGTCGAGGCCGGAGCCGACAATGCCGGCCAT
TACCTGTGGCTGCTCCAGATGCGTTACGTCTACACGCCCGAGGGGGACTTCCTCGGCCGGCTGCACGTCAGCATG
GCCAATGCCAAGCTCAACTACGGCTTCGAGTACCTGGGCGTCCCGGACCGTCTCGTGCGGACGCCCCTGACGGAC
CGGTGCTTCCTCACCTTGACGCAGGCTCTGTGCCAGCGTCTGGGGGGTTCGCCGTACGGCCCGGCCGGCACGGGC
AAGACGGAGTCGGTCAAGGCTCTCGGCCTTCAGCTCGGCCGCTTCACGCTCGTCTTCTGCTGCGACGACACGTTC
GACTTTCAGGCCATGGGCCGCATCTTCCTCGGCATATGCCAGGTCGGCGCCTGGGGATGCTTCGACGAGTTCAAC
CGGCTCGAGGAGAGGATCCTGTCGGCCGTGTCGCAGCAGATTCAGAATATCCAGCTCGGCCTCAGGCAGGGTGCC
GAGGACGACGCGTCGTCGCAGATCGAGCTGGTCGGCCGCCAGCTGAGCGTCAATGAGAACACGGGCATCTTCATC
ACCATGAACCCGGGCTACGCTGGCCGTTCCAACCTGCCGGACAACCTCAAGAAGCTCTTTCGCAGCGTGGCCATG
TCCAAGCCCGACAAGGAGCTCATCGCCGAGGTCATGCTCTACTCCCAAGGCTTCAGCCAGGCCAAGCGGCTGTCC
AAGCAGACGGTTCCCTTCTTCGAGCAGTGCTCGGGCCGGCTCTCGAAGCAGGCTCACTACGACTTTGGTCTCCGT
GCCCTCAAGAGCGTCCTCGTCAGCTCGGGAGGGCTCAAGCGCGCCCGTCTCAACGACGGCGGCGAGGACGAGGGC
GTGGTGGAGCCGGAAATCATCGTGCAGAGCATCCGCGAGACCATCGCGCCCAAGCTGATCAAGGCCGACGTGGAG
CTCATGACGGGCATCGAAGCCGACTGCTTCCCCGGCGTTCCGTACGTGCCGGCCAACCTCGGGGACCTGGAGGAG
GCGATTCGCGTGCTGGCGGCGGAGCGGCACTTGGTGGTGACGGACACGTGGATGACCAAGATCCTCCAGCTGTAC
CAGATTCAGAAGATTCATCACGGCGTCATGATGGTGGGCAACTCGGGCAGCGGCAAGTCGGCCGCCTGGAGGTTG
CTGCTCGACGCGCTGCAAAAGGTCGAGGGCGTCGAGGGCGTCTTCCACGTCATCGACTCCAAGGTCATGTCCAAG
GAGGCCCTCTACGGCAACCTGGATCCGACGACGCGCGAGTGGACCGACGGCCTGTTCACGAGCATCCTGCGCAAG
ATTGTGGATAACCTCAGGGGCGAGGACGCCAAGAGGCATTGGATCGTCTTCGACGGCGACGTCGATCCGGAATGG
GTCGAGAACCTCAACAGCGTGCTCGACGACAACAAGCTGCTGACGCTGCCCAACGGCGAGCGGCTCAGCCTCCCG
GCCAACGTCCGCATCATGTTCGAGGTCGAGACGCTGCGGTACGCGACGCTGGCGACGGTCAGTCGCTGCGGCATG
GTCTGGTTCAGCGAAGACACGGTGACGCCGGACATGCTGGTGGCGCACTATCTCGAGACGCTGGGCAGCGTCCCC
TTTGAGGACCTGGACGAGGACAGCGTGGCGACGGGCCAGGCGCCGGCGCGGATCCTGGCCGTTCAGGCCCGGGTG
GCCGACCTGCTGCGGTCGCATCTCTGTGCCGACGACTTCGTGGCCCGGGTGCTGGCGAGGGCTCAGGAGTACGAC
CACATCATGGACTTTACCGTCGCCCGCGTCCTCACCACGCTCTTCTCGCTCCTCAACAAGGCGGTGAGGGACGTG
ATCGAGTACAATGGCCGGCACGCAGACTTTCCCCTGGACGCGGACCAAGTCGAGGCCTTTGTGCCCAAGAAGCTG
CTGCTGGCGCTGGTGTGGGCTCTGACGGGCGACTGTCCGCTGGCTGACCGCAAGGCCTTCGGCGACGACGTCTGT
GCCATGGCCAGCTTCGGGTCTCCGCCCCTGGACGGCAGCGGCAGCTCGCTCATCGATTTCGACGTCAGCCTGCCC
AGGGCCGAGTGGACGCCGTGGCAGGACCAGGTGCCTACCGTCGAGGTCAACACGCACTCGATCACGCAGACGGAC
GTGGTGATTCCCACGCTCGATACGGTCCGGCACGAGGACGTGCTCTACTCGTGGCTGGCAGAGCACAAGCCCTTG
CTGCTCTGCGGTCCGCCGGGCTCGGGCAAGACGATGACGCTCTTCAGTGCCCTCCGCAAGCTGCCCAACATGGAG
GTGGTCGGCCTCAACTTCTCCAGCGCGACGACGCCGGGCCTCCTCATCAAGACGTTTGAGCAGTATTGCGAGTAC
AAGAAGACGCTCAACGGCGTGATGCTCTCGCCCACGCAGATCGGTCGTTGGCTCGTCGTCTTTTGTGACGAGATC
AACCTGCCGGCTCCGGACAGGTACGGCACGCAGCGGGCCATCTCGTTCCTGAGGCAGCTGGTGGAGCACAACGGC
TTCTGGCGGACGTCGGACAAGTCGTGGGTGACGCTGGACCGGATCCAGTTCGTCGGCGCCTGCAACCCGCCCACG
GACGCGGGCCGGACGGCGCTCGGGGCTCGCTTCCTCCGGCACGCGCCGCTCGTCATGGTCGACTACCCGGGCGAG
CTCTCGCTCAACCAGATCTACGGCACCTTCAACGCGGCCGTGCTCAAGGTGGTGCCGTCGCTGCGCGGGTACGCC
GAGGCGCTGACGCAGGCCATGGTGCGCTTCTACCTCGAGTCGCAGCGGCGGTTCACGCCCGAGATACAGCCGCAT
TACGTCTACAGCCCGCGCGAGCTCACGCGCTGGGTCAGGGGCGTGTACGAGGCCATCCGGCCGCTCGAGGGGCTG
TCGGTCGAGGGCCTGATGCGCGTGTGGGCGCACGAGGCGCTGCGCCTCTTCCAGGACCGGCTGGTGGACGAGTCG
GAGAGGGCGTGGACGGACGAGGCCGTCCGACGCATTGCCTCGGAGCACTTCCCCAACGTCGACGAGGAGAAGGCG
CTGGGCGGGCCCATCCTGTTCTCCAACTGGTTGTCGCGCAACTACGTGCCGGTCGAGAGGGAGCGGTTGCGCGAG
TTCGTCAAGGCGCGGCTCAAGACGTTTTGCGAGGAGGAGGTGGACGTGCCGCTGATCCTGTTCAACGACGTGCTG
GAGCATGTGCTCCGCATCGACCGCGTCTTCCGGCAGCCGCAGGGTCATTTGATACTGATTGGCGTCAGCGGCAGC
GGCAAGACGACGCTGTCGCGGTTCGTGGCCTGGATGAACGGCCTCAAGGTGTTTCAGATCAAGGTGCACGGCAAG
TACTCGGCCGACGACTTCGACGAGGACCTGCGGGACGTGCTGCGGAGGTGCGGCTGCAAGGGTGAGAAGATGTGC
TTCATCATGGACGAGGCCAACGTGCTCGACTCGGGCTTCTTGGAGCGCATGAACACGCTGCTGGCCAACGCCGAG
GTCCCCGGCCTGTTCGAGGGCGACGAGTACGCGGCCCTGATGACGGCCTGCAAGGAGGGGGCGCAGCGGCAGAAC
CTGCACCTCGACTCTCCCGAAGAGCTGTATCGCTGGTTCACGCAGCAGATCGTCAACAACCTGCACGTCGTCTTC
ACCATGAACCCGCCCGAGGGGGGGCTGTCGTCCAAGGCGGCGACGAGCCCGGCGCTGTTCAACCGTTGCGTGCTC
AACTGGTTCGGCGACTGGTCGGACCAGGCGCTCTTCCAGGTCGGTCACGAGCTGACGCAGTCGGTCGACCTGGAC
CGCGGCGCATACCGGGCTCCCGACTCGATACCGGCGGCGTATCGGGGCCTGTCGATGCCGCCGACGCACCGCGAG
GCCGTGGTCAACTCGATGGTCCACATCCACTACTCGCTGGGGCGGTACAACGAGAAGCTGCTCCGGCAGCAGAAC
AAGCTGACCTTCCTGACGCCGCGGCACTTCCTCGACTTCGTGGGCCAGTTCGTGCGCTTGTACAACGAGAAGCGG
GAGGACCTGGAGGAGCAGCAGCGGCACCTCAACGTCGGGCTCGAGAAGCTGCGCGACACGGTGGACAAGGTGCGC
GATCTGCGGGCCAGCCTGGCGGACAAGAAGACGCAGCTGGAGCGCAAGGACGCCGAGGCCAACGAGAAGCTGCAG
CGGATGGTGGCGGACCAGCGCGAGGCGGAGCAGCGGCGGACGACGTCGCTGGAGATTCAGCAGGCGTTGGAGAAG
CAGGAGGCCGAGGTGGCGACGCGGCGACGGGTCGTGCTGGAGGACCTGGCCAAGGCCGAACCGGCCGTCGAGGAG
GCCAAGGCGAGCGTCAGCAACATCAAGAGGCAGCACCTGACGGAGGTGCGGTCGATGGGCAACCCGCCTCAGGGG
GTGAGGCTGGCGCTCGATGCCGTCTGCACGCTGCTGGGCCACCGGATCGTGGACTGGAAGGCGGTGCAGGCCGTG
GTCCGGCGAGACGACTTCATCGCCAGCATCATCATGTTCGACAACGGGCGGCAGATGACGAGGGCTCTGCGGGCC
AAGATGCGCAACGACTTCCTCTCCAACCCGGAGTTTACGTTCGAAAAGGTCAACAGGGCGTCCAAGGCGTGCGGT
CCGCTGGTGCAGTGGGTGGCGGCCCAGGTCAACTACTCGGACATACTGGACCGCGTCGGGCCGCTCAAGGACGAG
GTCGGCCGGCTGGAGGAACGGGCGCTGCAGACGAAGGCCGAGGCTCGGGCGGTCGAGGCCAACATCGGCGCGCTC
GAGGCCAGCATCGACACGTACAAGACGGAGTACGCGGCCCTCATCAGCGAGACGCAGGCCATCAAGTCGGAGATG
GCAAAGGTCCAGTTCAAGGTGGACCGCAGCGTCCGGCTGCTCGACAGCCTGTCTTCGGAGAGGACCCGATGGGAG
GAGGGCAGCCGGTCGTTCGAGACGCAGATCGGCACGCTGGTGGGCGACGTGCTGGTGGCGGCCGCCTTCGTGGCC
TACAGCGGCCTCTACGACCAGACGTTCCGCAAGTCCATGATGGACGACTGGTGCCATCAGCTTCACCTCTCGGGC
ATCCTGTACAAGTCGCCCAACCCGGTGACGGACTATCTGTCGACGGCGGACGAGCGGCTGGGCTGGCAGGAGAAC
ACGCTGCCGGCGGACGACCTGTGCACGGAGAACGCCATCATCCTGAAGCGCTTCAACCGCTATCCCCTCATCATC
GATCCGTCGGGGAGGGCGACCGAGTTCCTGCAGCGCGAGTGTCGCGACAGGCGGCTGACGGTGACGAGCTTCCTC
GACGACGGCTTCACCAAGCAGCTCGAGAGCTCCCTGCGCTTCGGCAACCCGATCCTGATACAGGACGCCGAACAC
CTGGACCCCATCCTCAACCACGTGCTCAACAAGGAGTATCAGCGCACGGGGGGCCGGGTGCTGATGCAGCTGGGC
AAGCAGGAGATTGACTTCTCGCCCTCGTTCCGCCTCTACCTTTCGACGCGCGATCCGTCGGCCCAGTTCGCGCCC
GACATCTGCAGCAGGGCTACCTTTGTCAACTTCACCGTCACAAAGGGCAGCTTGCGGACGCAGTCGCTCAACGAC
GTGCTCAAGTCGGAGCGGCCCGACGTCGACGAGCGCCGGACCGACCTCATCAAGCTGCAGGGAGAGTTCAAGGTT
CACCTACGCCAGCTGGAGAAGCAGCTGCTGCAGGCCCTCAACGAGTCGCGCGGCAACATCCTCGACGACGACAAG
GTCATCGAGACGCTCGAGACGCTCAAGACGGAGGCCGCCGACATCTCGGCCAAGATGAGCAGCACCGAGGGCGTC
ATGGCCGAGGTGGAGGACATCACGAGACAGTACGGCGTCATCGCCAACTCGTGCAGCGCCGTCTTCGCCGTGCTG
GATCAGCTGCACTTTCTCAACCACTTCTACCGCTTCTCGCTGCATTACTTCCTCGACATCTTCCGCACGGTCCTG
CACGGCAACGCCAATCTCGAGGGCGTGGCCGATCACCACGGCCGTCGCGACATCATCGTCCGCGACCTGTTCGTC
AACACGTTCAAGCGGACGGCGCTGGGGCTGCTGCAGAAGGACCGCATAACGCTGGCGGTGCTGCTGGCTCAGGCG
TCGCCCTACGCCATGGACAGGGGGCTGATGGACGCGGTGCTCGACGGCGACGTCCGGGGTCGCGACCTGTCGTCG
GAGGAGGGGGCGGGCGAGGAGGCGCGTCGAGAGGCCATGACCCGGGCCGGACGGCTGCCCGCGCTACGGGGCCGG
CTGGGGAGGGTGTCGGGCGAGGAGTGGGAGCGCTTCCTCACGGACGAGCTGGCCGAGGACTGCGTCCCGCGGGGG
CTGTTGTCGGGCGGCGGCGGCGGTGACGGAGAAGATGATGAGGGGGCCGAGGGGGCCGAGGGGGCCGAGGGTGCC
GAGATGCGGACGCTGAGCCCCGTCGACGAGGCTCTCCTCTCGCTGCTCGTCGTCAAGCTGTTCCGGATGGACCGG
TTCGTGCCGGCGGCCGAGCGGTTCGTGGGCCGCGTCTTCGGGCCCGAGATGCTGGACCACGTCGAGGACCTCGCC
GAGACGGTCGGCCAGGTCTCGGCCACGGTCCCCCTCGCGCTCGTGTCCAGCCCGGGCTTCGACGCCAGCTACAAG
GTCGACGGGCTGGTGGAGCGAAAGGGGGTGCGGTGCACCAACATCGCCATGGGCTCCAACGAGGGCCTGGCCAGC
GCGGACAAGGCCATCAGTCACGCCGCCCAGACGGGATCGTGGGTCCTGGTCAAGAACGTCCACCTGGCGCCCACC
TGGCTGCAGAGCCTGGAGAAGCGGATGGAGGCGCTGAGCCCGCAGGACGACTTCCGGCTGTTCCTGTCGATGGAG
TCGAGTCCGCGGATCCCGGTGAACCTGATCCGGGCGTCGAGGGTGCTCATGTACGAGCAGCCGGCCGGGGTGAGG
GCCAACATGAAGGACTCGATGTCTTCGCTCTCGACGAGGGCGGGGAGGGCGCCGGTCGAGAGGGCGAGGCTTTAC
CTGTTGATCTGCTTCCTGCACGCCGTCGCGCAGGAGAGGTTGCGGTACGCGCCGAGTCTGGGGTGGAAGGGGTTC
TGGGAGTTTAACGACAGCGATGTGAGTTTTTTTTTTTGTGTTTCGAGACGTCTTCGCGTGTGTTGAAGGAACCAA
AAAAAAAAAAAAAAAAAAAAAAAGAAGGGAACGCTGACGGGGGGAGACGTGTTCAGTATGAGTGCTCGGCTTTCA
TCATCGATACCTGGCTGGAGAGGACGGCCGGACGGCGAAGCAACATGGCCCCGGCCAACATGCCGTGGGAGATGA
TGCGGCATCTCGTCAGCGAGACGTACGGCGGCAAGATCGACGACGAGGAAGACCTGAAGCTGCTGCGGAAGCTGG
TATGGTCTCTCCTGACGCCGACGGCCTACGACGCGGACCACCAGCTCATGGGCGGGCTCCGGTTGCCGTCGGGGA
CGAGCGTGCAGGACTTTATGGGCTGGATCCACGAGTTGCCGGAGAGGGAGCCGCCGACGTATCTGGGGTTGCCGG
CGGACGCGGAGAAGTTGTTGCTGGTGGGGATGGGGAGGAGGTTGGTTGGGGATGTGGGGAGGGTGACGGAGTTGT
TGGATCAGGGGAGCAGCTCGTTACGGAGGGGGAGTAGGGGAGTGGAGAGGAGAGGGAGGAATGTTTGTGGGTTGT
TGGTATTTGCGGTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGTGGTTGT
GGTGGTGGTGGTGGTTGTGGTTGTGGTTGTGGTGGTGGTTGTGGTGGTTGTAGTGGTTGTAGTAGTTGTGATTGC
GGTGGTTGTGGTGGTGCTGAAACACAGCCAGCCTAGACACCTATAAATAGAGCAATATCTGCGTGTGAGTGAGTC
GACTGTCTCACCGTGTTCTACATACACCTACATATGTATGTACAGCCGGTCTACGGATACAGGCTCACCTACCTA
CCCTACCAAGGTAGACACAGTAAGCGGAGCTGGTAGTCCGGGGCTCGAGCCGGGCGGTTGCAGAGCATGTCGTCA
TGGTCTTGGCATGCACGTATGTATGTATGTATATTGTCTGTACGTATGTGTATGTATGTGTATTCGTGTGTATGT
ATTCGTGTGTATGCACAAACTGCGTACCAAGTACGACGTCATCTTCACCTACATAGTACGAATACCCAGCACCAG
CAATCCTCCGTGATGAGGCGTATGTATGTATCGTATGTATTGAACGAATACGCCCGCATATGTAGGTATGCTCTG
ACTCTCTCCTCTCTCTCTCTCTCTCTCTCCCTCACACACACACACACACACACAGTGCACGCACGCGTCCACTCG
TCACCCGGCTGTCTCATCCCGTCATCCCCGCATGTTGGCTCGAGGTATTCGTACGGTGCGGTTGCCGGCTTACTT
ATAGATAGATGTTGGGGGGGAAGTTCGTCTCCCCCTCTTTCTTGTCTTTTTTTTTTTTTTTCTTGTCTCCTTTTC
TACTTTCTTCTCAAACGTTTGCCACGCTTTCTTTCTAGGAGAGAGCGATATTCGCCATGGCTAACTGGCAGCAGT
GTTTGTCTACCCCCGAATTCCCCCCCCCCCCCAAAATCCACAGCACATCTAACCTATCGTATGTACGGAATACAC
CCTCAGATAACCCCTTCAGCAAGCGCGAATCCCATAGCGCGGCCTCCATCACAACCTACAAGATCCTCACCCTCC
TAACCTGGATCCTCTCCGTCGTCGTCTCCATCTACTACACCGTCCACGCGCCCCACGATGGCTTCACCATCCGTC
ACCGCATCTGGGACCAGAATTACCTGTACCCCAGCGCCTTCACCATGAATCACGTCCTCGCCGACATCTACTGGC
TCGTCCTCTTCATCCTTCAGGCCGGTTACGTGGCGCACCTCTTCTCCGGCAAGTCCGAGACGGTGTACGCTGCCT
CTTCGGTGGGGAGTCACTTCGTGCTGAACAACCTGCTGCACTTTGCCTTTGTCATGTTGTTTGTGCGGTCGCATT
TTCATTGGGCTGAGGTCATGCTCGTCATCAACTTTGTCAACCTCAGCTCTCTGTACTTTCGCCATCATGCGCATG
GGCGATTCATCCATGGGCCTGCCGTTTCGGGGCCTTTGGCTTGGACTTTTGTCGCCATTTATTGGAACGGGGCCA
TCATGGTGCCGCATCAGCATAATCTCGTGGCCCGCGTGTTTGGCAACATCTTCATCTGGTCCATCCTCGGCTACG
GAGCCTTCTTCATCGTTGCTTACAAGGTGCGTCGCATCTACCGAAAATTCAACCCTCCTTCGAGATGGGCTGTGC
TGATTCTACTCGACAGGACTACACCATGGGCTTCGCGCTCAGCGTCCTGGCTGCGGCCATTGGCGTGGCGCAGTT
TGAGAGGCAGGTCGTTGCCTTGCAGTGGATCTTCGCCTTTGTCATCATGGCGGTTTTGTTCGTCATGACGCTGGT
GGTTGCTTTGCCGGCTTGGGCGGGTAGGGATTTGAGGTGGAGGCGGGCTGAGGCTGATCAGGAGAGGGCGCCTTT
GCTGGAGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail