Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03938
Gene name
Locationscaffold_04:409908..412207
Strand+
Gene length (bp)2299
Transcript length (bp)2130
Coding sequence length (bp)2130
Protein length (aa) 710

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09794 Avl9 Transport protein Avl9 1.8E-145 22 399

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6352 0.1919 0.2169 0.2118 0.201 0.0291 0.2112 0.4544 0.6123 0.0545

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4461
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4800
Ophiocordyceps australis map64 (Brazil) OphauB2|3568
Ophiocordyceps camponoti-floridani Ophcf2|03938 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6208
Ophiocordyceps kimflemingae Ophio5|4775
Ophiocordyceps subramaniannii Hirsu2|9261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03938
MSSGDDSSSLDGASSTPFAPLVTVVGFHHARGPEVETWFGVEDGSDPCTDFSWSLLPFMALSDGAHASEEDFSYF
TLLRPAADFQPATSLFGISCTRQLDASQLFNRPSDVTRSTVQKAVVVIADSPQSFGMLRERLSIVTQAWFAQRDF
TDVEILRRFQESLADEKERGALASDANRDQYLGMSLRELIHEFKWQTLVLFKCCLLQPKMLFFGSRCDRLCMVQF
SLISLIPGLLRSLQDCADPDLDSYEKKLSRPSSLQSSNRSSLLSFMGLPLQIFGKGGFFGPYTPLQQLDILADFG
TKSYLVGSTNSLLLQQRDRYSDILINLDEDTVTITSPSLRSALALTAADRRWIDFITQEVNETWDEANPDRPKTM
QYIGSEEFIRSQFEAYILGLISSVKYHNFLASNADGSKGAEDPAVDFGLDWVEAWERTENYRMWNTHTDANLFAV
SEPKHPCAGGLTMDDVQRRISEQVKELHLDERFAQGREMLGRNLAVGREKASTMLNKLYADVEYLRESQRRRSDE
SSPQDTKSPSEKPQAQYPVDLAKAQQTMQSVGVKASAYVSSWASWAGEKRKGGGWGAAWGRKPKTASDAASPVKQ
ATSPRSSRTPSMDDFANNRPPTQASFSESILSGASGSLDERRLSKSSAADMSSIQGEDVRRASLISIHEEKEEPT
NPPCKNPPSSPPPRPLNPWSKPKPHPHKARIRVP*
Coding >Ophcf2|03938
ATGAGCAGCGGCGACGATAGCAGCTCCCTCGACGGGGCTTCGTCGACGCCCTTTGCGCCCCTCGTCACCGTCGTC
GGCTTCCACCACGCTCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTCGAGGATGGTTCCGACCCTTGCACCGAC
TTCTCCTGGTCTCTGCTGCCCTTTATGGCCCTGAGTGATGGCGCTCACGCATCCGAAGAAGACTTCTCCTACTTT
ACCCTGCTAAGGCCCGCCGCCGATTTCCAGCCCGCCACGTCTCTGTTCGGCATCTCGTGCACTCGACAGCTCGAC
GCGTCTCAGCTCTTCAACCGCCCCTCCGACGTCACGCGTTCCACGGTCCAAAAGGCCGTTGTCGTCATCGCCGAT
AGCCCCCAATCTTTTGGCATGCTGCGCGAGCGCCTGAGCATCGTCACTCAGGCTTGGTTCGCCCAGCGAGACTTT
ACCGACGTCGAAATCCTGCGCCGATTCCAGGAGAGCCTGGCCGACGAGAAAGAAAGGGGCGCCTTGGCCAGCGAC
GCTAACCGGGACCAGTACCTCGGCATGAGCTTGCGCGAGCTCATACATGAGTTCAAGTGGCAGACGCTGGTCCTC
TTCAAGTGCTGTCTTCTGCAGCCCAAGATGCTCTTCTTCGGCTCCCGCTGCGACAGGCTGTGTATGGTCCAATTT
TCCCTCATCTCCCTGATACCAGGACTCTTGCGCAGCCTGCAAGACTGCGCCGACCCAGACCTCGACAGCTACGAA
AAGAAGCTTTCGCGGCCGTCGAGTCTGCAAAGCAGCAACCGGAGCTCCCTCCTGTCATTTATGGGGCTTCCCCTG
CAGATCTTTGGCAAGGGCGGCTTCTTCGGCCCCTATACGCCACTGCAGCAACTCGACATCCTGGCCGACTTTGGC
ACCAAGTCGTATCTTGTCGGCAGCACCAACTCACTGCTTCTCCAGCAGAGGGACCGATACAGCGACATACTCATC
AACCTCGACGAGGACACCGTCACCATCACATCGCCGTCCCTGAGGTCAGCCCTAGCCCTGACCGCGGCCGACCGT
CGATGGATCGACTTCATCACCCAAGAGGTCAACGAGACGTGGGACGAGGCGAACCCCGACAGGCCCAAGACGATG
CAGTACATTGGTAGCGAGGAGTTTATCCGGTCACAGTTCGAGGCCTACATTCTCGGCCTGATATCGTCTGTCAAG
TATCACAACTTCTTGGCCTCCAATGCCGACGGCTCCAAGGGGGCCGAGGATCCGGCCGTCGACTTTGGCCTGGAC
TGGGTCGAGGCTTGGGAGCGCACAGAGAATTACCGAATGTGGAACACGCACACCGACGCCAACCTCTTTGCCGTC
TCGGAGCCCAAGCACCCGTGCGCCGGCGGCCTCACCATGGACGACGTCCAGAGGCGCATCTCGGAACAGGTCAAG
GAGCTACATCTCGACGAGCGCTTCGCCCAGGGCCGCGAGATGCTGGGCCGCAACCTGGCCGTCGGTCGCGAAAAG
GCATCGACGATGCTCAACAAGCTCTACGCCGACGTCGAATATCTACGCGAATCCCAACGTCGCCGTTCTGACGAG
TCCAGCCCTCAGGACACCAAGTCGCCGTCAGAGAAGCCGCAAGCCCAGTACCCGGTCGATCTCGCCAAGGCACAG
CAAACAATGCAATCGGTGGGCGTCAAAGCCAGCGCCTACGTCTCCAGCTGGGCCAGCTGGGCAGGTGAGAAGCGC
AAGGGCGGAGGCTGGGGCGCGGCATGGGGTAGGAAGCCCAAGACGGCCTCTGATGCAGCCAGTCCAGTCAAGCAA
GCCACCAGTCCGCGCTCATCTCGTACGCCCTCGATGGACGACTTTGCGAACAACAGGCCGCCGACGCAGGCTAGT
TTCAGCGAGAGCATCCTCTCCGGCGCCAGTGGCTCCCTCGACGAAAGACGCCTGTCCAAGTCCTCGGCCGCGGAC
ATGTCTAGCATCCAGGGTGAAGACGTCCGCCGAGCATCACTGATAAGCATCCACGAAGAAAAAGAAGAGCCAACG
AACCCCCCATGCAAAAATCCCCCATCATCCCCCCCTCCCCGACCCCTGAATCCATGGTCCAAACCGAAGCCTCAC
CCGCACAAAGCCCGCATCCGAGTCCCCTAG
Transcript >Ophcf2|03938
ATGAGCAGCGGCGACGATAGCAGCTCCCTCGACGGGGCTTCGTCGACGCCCTTTGCGCCCCTCGTCACCGTCGTC
GGCTTCCACCACGCTCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTCGAGGATGGTTCCGACCCTTGCACCGAC
TTCTCCTGGTCTCTGCTGCCCTTTATGGCCCTGAGTGATGGCGCTCACGCATCCGAAGAAGACTTCTCCTACTTT
ACCCTGCTAAGGCCCGCCGCCGATTTCCAGCCCGCCACGTCTCTGTTCGGCATCTCGTGCACTCGACAGCTCGAC
GCGTCTCAGCTCTTCAACCGCCCCTCCGACGTCACGCGTTCCACGGTCCAAAAGGCCGTTGTCGTCATCGCCGAT
AGCCCCCAATCTTTTGGCATGCTGCGCGAGCGCCTGAGCATCGTCACTCAGGCTTGGTTCGCCCAGCGAGACTTT
ACCGACGTCGAAATCCTGCGCCGATTCCAGGAGAGCCTGGCCGACGAGAAAGAAAGGGGCGCCTTGGCCAGCGAC
GCTAACCGGGACCAGTACCTCGGCATGAGCTTGCGCGAGCTCATACATGAGTTCAAGTGGCAGACGCTGGTCCTC
TTCAAGTGCTGTCTTCTGCAGCCCAAGATGCTCTTCTTCGGCTCCCGCTGCGACAGGCTGTGTATGGTCCAATTT
TCCCTCATCTCCCTGATACCAGGACTCTTGCGCAGCCTGCAAGACTGCGCCGACCCAGACCTCGACAGCTACGAA
AAGAAGCTTTCGCGGCCGTCGAGTCTGCAAAGCAGCAACCGGAGCTCCCTCCTGTCATTTATGGGGCTTCCCCTG
CAGATCTTTGGCAAGGGCGGCTTCTTCGGCCCCTATACGCCACTGCAGCAACTCGACATCCTGGCCGACTTTGGC
ACCAAGTCGTATCTTGTCGGCAGCACCAACTCACTGCTTCTCCAGCAGAGGGACCGATACAGCGACATACTCATC
AACCTCGACGAGGACACCGTCACCATCACATCGCCGTCCCTGAGGTCAGCCCTAGCCCTGACCGCGGCCGACCGT
CGATGGATCGACTTCATCACCCAAGAGGTCAACGAGACGTGGGACGAGGCGAACCCCGACAGGCCCAAGACGATG
CAGTACATTGGTAGCGAGGAGTTTATCCGGTCACAGTTCGAGGCCTACATTCTCGGCCTGATATCGTCTGTCAAG
TATCACAACTTCTTGGCCTCCAATGCCGACGGCTCCAAGGGGGCCGAGGATCCGGCCGTCGACTTTGGCCTGGAC
TGGGTCGAGGCTTGGGAGCGCACAGAGAATTACCGAATGTGGAACACGCACACCGACGCCAACCTCTTTGCCGTC
TCGGAGCCCAAGCACCCGTGCGCCGGCGGCCTCACCATGGACGACGTCCAGAGGCGCATCTCGGAACAGGTCAAG
GAGCTACATCTCGACGAGCGCTTCGCCCAGGGCCGCGAGATGCTGGGCCGCAACCTGGCCGTCGGTCGCGAAAAG
GCATCGACGATGCTCAACAAGCTCTACGCCGACGTCGAATATCTACGCGAATCCCAACGTCGCCGTTCTGACGAG
TCCAGCCCTCAGGACACCAAGTCGCCGTCAGAGAAGCCGCAAGCCCAGTACCCGGTCGATCTCGCCAAGGCACAG
CAAACAATGCAATCGGTGGGCGTCAAAGCCAGCGCCTACGTCTCCAGCTGGGCCAGCTGGGCAGGTGAGAAGCGC
AAGGGCGGAGGCTGGGGCGCGGCATGGGGTAGGAAGCCCAAGACGGCCTCTGATGCAGCCAGTCCAGTCAAGCAA
GCCACCAGTCCGCGCTCATCTCGTACGCCCTCGATGGACGACTTTGCGAACAACAGGCCGCCGACGCAGGCTAGT
TTCAGCGAGAGCATCCTCTCCGGCGCCAGTGGCTCCCTCGACGAAAGACGCCTGTCCAAGTCCTCGGCCGCGGAC
ATGTCTAGCATCCAGGGTGAAGACGTCCGCCGAGCATCACTGATAAGCATCCACGAAGAAAAAGAAGAGCCAACG
AACCCCCCATGCAAAAATCCCCCATCATCCCCCCCTCCCCGACCCCTGAATCCATGGTCCAAACCGAAGCCTCAC
CCGCACAAAGCCCGCATCCGAGTCCCCTAG
Gene >Ophcf2|03938
ATGAGCAGCGGCGACGATAGCAGCTCCCTCGACGGGGCTTCGTCGACGCCCTTTGCGCCCCTCGTCACCGTCGTC
GGCTTCCACCACGCTCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTCGAGGATGGTTCCGACCCTTGCACCGAC
TTCTCCTGGTCTCTGCTGCCCTTTATGGCCCTGAGTGATGGCGCTCACGCGTCAGTCGACCATCCACGGCCATGG
CTGCTGGACGCGCTGACAGCCCCAGATCCGAAGAAGACTTCTCCTACTTTACCCTGCTAAGGCCCGCCGCCGATT
TCCAGCCCGCCACGTCTCTGTTCGGCATCTCGTGCACTCGACAGCTCGACGCGTCTCAGCTCTTCAACCGCCCCT
CCGACGTCACGCGTTCCACGGTCCAAAAGGCCGTTGTCGTCATCGCCGATAGCCCCCAATCTTTTGGCATGCTGC
GCGAGCGCCTGAGCATCGTCACTCAGGCTTGGTTCGCCCAGCGAGACTTTACCGACGTCGAAATCCTGCGCCGAT
TCCAGGAGAGCCTGGCCGACGAGAAAGAAAGGGGCGCCTTGGCCAGCGACGCTAACCGGGACCAGTACCTCGGCA
TGAGCTTGCGCGAGCTCATACATGAGTTCAAGTGGCAGACGCTGGTCCTCTTCAAGTGCTGTCTTCTGCAGCCCA
AGGTGCGTCAATTCCTCCGCCCATCACAGGCGCAGGCTGACGCCCATTCGTGTGCAGATGCTCTTCTTCGGCTCC
CGCTGCGACAGGCTGTGTATGGTCCAATTTTCCCTCATCTCCCTGATACCAGGACTCTTGCGCAGCCTGCAAGAC
TGCGCCGACCCAGACCTCGACAGCTACGAAAAGAAGCTTTCGCGGCCGTCGAGTCTGCAAAGCAGCAACCGGAGC
TCCCTCCTGTCATTTATGGGGCTTCCCCTGCAGATCTTTGGCAAGGTTCGATAGGATAGCTTATTCTCTTCTTGA
TGGCGACGCTGACTCGTCTGCATAATGAACGCAGGGCGGCTTCTTCGGCCCCTATACGCCACTGCAGCAACTCGA
CATCCTGGCCGACTTTGGCACCAAGTCGTATCTTGTCGGCAGCACCAACTCACTGCTTCTCCAGCAGAGGGACCG
ATACAGCGACATACTCATCAACCTCGACGAGGACACCGTCACCATCACATCGCCGTCCCTGAGGTCAGCCCTAGC
CCTGACCGCGGCCGACCGTCGATGGATCGACTTCATCACCCAAGAGGTCAACGAGACGTGGGACGAGGCGAACCC
CGACAGGCCCAAGACGATGCAGTACATTGGTAGCGAGGAGTTTATCCGGTCACAGTTCGAGGCCTACATTCTCGG
CCTGATATCGTCTGTCAAGTATCACAACTTCTTGGCCTCCAATGCCGACGGCTCCAAGGGGGCCGAGGATCCGGC
CGTCGACTTTGGCCTGGACTGGGTCGAGGCTTGGGAGCGCACAGAGAATTACCGAATGTGGAACACGCACACCGA
CGCCAACCTCTTTGCCGTCTCGGAGCCCAAGCACCCGTGCGCCGGCGGCCTCACCATGGACGACGTCCAGAGGCG
CATCTCGGAACAGGTCAAGGAGCTACATCTCGACGAGCGCTTCGCCCAGGGCCGCGAGATGCTGGGCCGCAACCT
GGCCGTCGGTCGCGAAAAGGCATCGACGATGCTCAACAAGCTCTACGCCGACGTCGAATATCTACGCGAATCCCA
ACGTCGCCGTTCTGACGAGTCCAGCCCTCAGGACACCAAGTCGCCGTCAGAGAAGCCGCAAGCCCAGTACCCGGT
CGATCTCGCCAAGGCACAGCAAACAATGCAATCGGTGGGCGTCAAAGCCAGCGCCTACGTCTCCAGCTGGGCCAG
CTGGGCAGGTGAGAAGCGCAAGGGCGGAGGCTGGGGCGCGGCATGGGGTAGGAAGCCCAAGACGGCCTCTGATGC
AGCCAGTCCAGTCAAGCAAGCCACCAGTCCGCGCTCATCTCGTACGCCCTCGATGGACGACTTTGCGAACAACAG
GCCGCCGACGCAGGCTAGTTTCAGCGAGAGCATCCTCTCCGGCGCCAGTGGCTCCCTCGACGAAAGACGCCTGTC
CAAGTCCTCGGCCGCGGACATGTCTAGCATCCAGGGTGAAGACGTCCGCCGAGCATCACTGATAAGCATCCACGA
AGAAAAAGAAGAGCCAACGAACCCCCCATGCAAAAATCCCCCATCATCCCCCCCTCCCCGACCCCTGAATCCATG
GTCCAAACCGAAGCCTCACCCGCACAAAGCCCGCATCCGAGTCCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail