Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03929
Gene name
Locationscaffold_04:385147..385870
Strand-
Gene length (bp)723
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 2.2E-06 102 126

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4588 0.8346 0.0165 0.0313 0.1416 0.0061 0.101 0.0201 0.0379 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4772
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6920
Ophiocordyceps australis map64 (Brazil) OphauB2|3919
Ophiocordyceps camponoti-floridani Ophcf2|03929 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5065
Ophiocordyceps kimflemingae Ophio5|5265
Ophiocordyceps subramaniannii Hirsu2|10093

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03929
MADPPKRSAYGAPADDTDFRKTYDLDEYAAKAREREAREKAEAKARYEARLAGKKHPTMTPTGNETFATARRTTL
DVASQVGKKQLVPAGAGVGRRGRSAGFYCEACDLTFKDNKQLVEHHNTTQHLLRTGQKPHVQRATAAEVRARIDI
LAARQEELRRDDATNLAERLRLRGEEQRRADEEKRRKRREGVEARRKQREEEKRAKADYGDDVRIEGEHDEDDMM
AQLGIVGFGGSKRKG*
Coding >Ophcf2|03929
ATGGCAGACCCTCCCAAGCGCAGCGCATACGGCGCTCCGGCAGACGACACCGACTTCCGCAAGACGTACGATCTG
GACGAGTATGCTGCCAAAGCCCGGGAGCGCGAGGCACGAGAAAAAGCCGAGGCAAAGGCGCGGTACGAGGCACGA
CTAGCGGGCAAGAAGCATCCCACGATGACGCCAACGGGCAACGAGACGTTCGCCACGGCGCGACGCACGACGCTC
GACGTGGCCTCACAAGTTGGCAAGAAACAACTGGTACCGGCGGGAGCGGGCGTCGGGCGTCGCGGTCGAAGCGCG
GGATTCTACTGCGAGGCTTGCGACCTCACCTTCAAAGACAACAAACAGCTAGTCGAACATCACAACACGACGCAG
CATCTGCTGAGAACGGGGCAGAAGCCGCATGTGCAGCGCGCCACGGCCGCCGAGGTCCGCGCCCGCATCGACATT
CTGGCTGCGCGCCAAGAAGAGCTTCGACGTGACGACGCTACAAACTTGGCTGAACGGCTGCGGCTGCGTGGCGAG
GAGCAGAGGCGGGCGGATGAGGAGAAGAGGAGGAAGCGGCGGGAGGGAGTCGAGGCGAGGAGGAAGCAGCGTGAG
GAGGAGAAGCGGGCGAAGGCTGACTATGGGGATGATGTACGGATTGAGGGCGAGCATGACGAGGATGATATGATG
GCTCAATTGGGGATCGTAGGCTTCGGCGGCTCCAAGAGGAAGGGCTGA
Transcript >Ophcf2|03929
ATGGCAGACCCTCCCAAGCGCAGCGCATACGGCGCTCCGGCAGACGACACCGACTTCCGCAAGACGTACGATCTG
GACGAGTATGCTGCCAAAGCCCGGGAGCGCGAGGCACGAGAAAAAGCCGAGGCAAAGGCGCGGTACGAGGCACGA
CTAGCGGGCAAGAAGCATCCCACGATGACGCCAACGGGCAACGAGACGTTCGCCACGGCGCGACGCACGACGCTC
GACGTGGCCTCACAAGTTGGCAAGAAACAACTGGTACCGGCGGGAGCGGGCGTCGGGCGTCGCGGTCGAAGCGCG
GGATTCTACTGCGAGGCTTGCGACCTCACCTTCAAAGACAACAAACAGCTAGTCGAACATCACAACACGACGCAG
CATCTGCTGAGAACGGGGCAGAAGCCGCATGTGCAGCGCGCCACGGCCGCCGAGGTCCGCGCCCGCATCGACATT
CTGGCTGCGCGCCAAGAAGAGCTTCGACGTGACGACGCTACAAACTTGGCTGAACGGCTGCGGCTGCGTGGCGAG
GAGCAGAGGCGGGCGGATGAGGAGAAGAGGAGGAAGCGGCGGGAGGGAGTCGAGGCGAGGAGGAAGCAGCGTGAG
GAGGAGAAGCGGGCGAAGGCTGACTATGGGGATGATGTACGGATTGAGGGCGAGCATGACGAGGATGATATGATG
GCTCAATTGGGGATCGTAGGCTTCGGCGGCTCCAAGAGGAAGGGCTGA
Gene >Ophcf2|03929
ATGGCAGACCCTCCCAAGCGCAGCGCATACGGCGCTCCGGCAGACGACACCGACTTCCGCAAGACGTACGATCTG
GACGAGTATGCTGCCAAAGCCCGGGAGCGCGAGGCACGAGAAAAAGCCGAGGCAAAGGCGCGGTACGAGGCACGA
CTAGCGGGCAAGAAGCATCCCACGATGACGCCAACGGGCAACGAGACGTTCGCCACGGCGCGACGCACGACGCTC
GACGTGGCCTCACAAGTTGGCAAGAAACAACTGGTACCGGCGGGAGCGGGCGTCGGGCGTCGCGGTCGAAGCGCG
GGATTCTACTGCGAGGCTTGCGACCTCACCTTCAAAGACAACAAACAGCTAGTCGAACATCACAACACGACGCAG
CATCTGCTGAGAACGGGGCAGAAGCCGCATGTGCAGCGCGCCACGGCCGCCGAGGTCCGCGCCCGCATCGACATT
CTGGCTGCGCGCCAAGAAGAGCTTCGACGTGACGACGCTACAAACTTGGCTGAACGGCTGCGGCTGCGTGGCGAG
GAGCAGAGGCGGGCGGATGAGGAGAAGAGGAGGAAGCGGCGGGAGGGAGTCGAGGCGAGGAGGAAGCAGCGTGAG
GAGGAGAAGCGGGCGAAGGCTGACTATGGGGATGATGTACGGATTGAGGGCGAGCATGACGAGGATGATATGATG
GCTCAATTGGGGATCGTAGGCTTCGGCGGCTCCAAGAGGAAGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail