Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03927
Gene name
Locationscaffold_04:383138..383816
Strand+
Gene length (bp)678
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16242 Pyrid_ox_like Pyridoxamine 5'-phosphate oxidase like 1.4E-22 30 182
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 8.7E-09 33 116

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Mitochondrion Peroxisomal targeting signal 0.5509 0.2043 0.0473 0.0307 0.6773 0.3908 0.2464 0.1701 0.0816 0.5309

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6918
Ophiocordyceps australis map64 (Brazil) OphauB2|3917
Ophiocordyceps camponoti-floridani Ophcf2|03927 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5063
Ophiocordyceps kimflemingae Ophio5|5263
Ophiocordyceps subramaniannii Hirsu2|10091

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03927
MSFSNTSVGDKPADPYRQANLDQVDVKTKVSDLVEFMTACKFSMMTTHEAATNNLVSRCMALAATETGGIDLLFY
TNTESHKTNDIASDSHINISFINATGEWASISGTASVVTDRDLVKKHYSPALKAWVGDLGDGTHDGSENDPRIGV
VRVKMNFGSYSLVAKNMLSRAAEVVQGAVTGKPAHVMKLREINPKEVEQWRSVHK*
Coding >Ophcf2|03927
ATGTCCTTCTCCAACACCTCCGTCGGCGACAAGCCCGCAGATCCCTACCGACAGGCCAACCTCGACCAAGTCGAC
GTCAAGACAAAGGTCTCCGACCTCGTCGAATTCATGACGGCCTGCAAGTTCAGCATGATGACCACCCACGAGGCC
GCCACCAATAACCTCGTGTCGCGATGCATGGCTCTGGCCGCGACTGAAACGGGCGGTATCGATCTGCTGTTCTAC
ACCAACACCGAGTCGCACAAGACCAATGACATAGCCAGCGATTCCCACATCAACATCTCCTTCATCAACGCCACG
GGCGAGTGGGCTTCCATCTCCGGTACCGCCTCCGTCGTCACCGACAGGGACCTCGTCAAGAAGCACTACTCGCCC
GCCCTCAAGGCCTGGGTCGGAGATCTGGGCGACGGCACCCACGATGGCTCGGAAAACGACCCCCGCATCGGCGTC
GTCCGCGTCAAGATGAACTTTGGAAGCTACTCGCTCGTCGCCAAGAACATGCTGAGCCGCGCAGCAGAGGTCGTG
CAGGGGGCCGTGACGGGTAAGCCTGCTCACGTCATGAAGCTGAGGGAAATCAATCCCAAAGAGGTCGAGCAATGG
CGCTCGGTACACAAGTAG
Transcript >Ophcf2|03927
ATGTCCTTCTCCAACACCTCCGTCGGCGACAAGCCCGCAGATCCCTACCGACAGGCCAACCTCGACCAAGTCGAC
GTCAAGACAAAGGTCTCCGACCTCGTCGAATTCATGACGGCCTGCAAGTTCAGCATGATGACCACCCACGAGGCC
GCCACCAATAACCTCGTGTCGCGATGCATGGCTCTGGCCGCGACTGAAACGGGCGGTATCGATCTGCTGTTCTAC
ACCAACACCGAGTCGCACAAGACCAATGACATAGCCAGCGATTCCCACATCAACATCTCCTTCATCAACGCCACG
GGCGAGTGGGCTTCCATCTCCGGTACCGCCTCCGTCGTCACCGACAGGGACCTCGTCAAGAAGCACTACTCGCCC
GCCCTCAAGGCCTGGGTCGGAGATCTGGGCGACGGCACCCACGATGGCTCGGAAAACGACCCCCGCATCGGCGTC
GTCCGCGTCAAGATGAACTTTGGAAGCTACTCGCTCGTCGCCAAGAACATGCTGAGCCGCGCAGCAGAGGTCGTG
CAGGGGGCCGTGACGGGTAAGCCTGCTCACGTCATGAAGCTGAGGGAAATCAATCCCAAAGAGGTCGAGCAATGG
CGCTCGGTACACAAGTAG
Gene >Ophcf2|03927
ATGTCCTTCTCCAACACCTCCGTCGGCGACAAGCCCGCAGATCCCTACCGACAGGCCAACCTCGACCAAGTCGAC
GTCAAGACAAAGGTCTCCGACCTCGTCGAATTCATGACGGCCTGCAAGTTCAGCATGATGACCACCCACGAGGCC
GCCACCAATAACCTCGTGTCGCGATGCATGGCTCTGGCCGCGACTGTGAGTGCTTGATGCTGTTCGCTACAATGA
CTTCGGCTCACTCCTCCCTCCTCCTCTCAGGAAACGGGCGGTATCGATCTGCTGTTCTACACCAACACCGAGTCG
CACAAGACCAATGACATAGCCAGCGATTCCCACATCAACATCTCCTTCATCAACGCCACGGGCGAGTGGGCTTCC
ATCTCCGGTACCGCCTCCGTCGTCACCGACAGGGACCTCGTCAAGAAGCACTACTCGCCCGCCCTCAAGGCCTGG
GTCGGAGATCTGGGCGACGGCACCCACGATGGCTCGGAAAACGACCCCCGCATCGGCGTCGTCCGCGTCAAGATG
AACTTTGGAAGCTACTCGCTCGTCGCCAAGAACATGCTGAGCCGCGCAGCAGAGGTCGTGCAGGGGGCCGTGACG
GGTAAGCCTGCTCACGTCATGAAGCTGAGGGAAATCAATCCCAAAGAGGTCGAGCAATGGCGCTCGGTACACAAG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail