Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03924
Gene name
Locationscaffold_04:374666..376967
Strand-
Gene length (bp)2301
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12657 TFIIIC_delta Transcription factor IIIC subunit delta N-term 3.7E-07 51 90

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4124 0.7832 0.1939 0.0499 0.077 0.0272 0.2602 0.0657 0.1095 0.0717

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup624
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5676
Ophiocordyceps australis map64 (Brazil) OphauB2|3914
Ophiocordyceps camponoti-floridani Ophcf2|03924 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5060
Ophiocordyceps kimflemingae Ophio5|2657
Ophiocordyceps kimflemingae Ophio5|5260
Ophiocordyceps subramaniannii Hirsu2|10086

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03924
MENANASGEGDDEKADNSSQSRSRSIKRDKQKSGSKRRVRPLETLELRFRPLAPHAISWSCDAELAIALDEAIHV
FLPEVGPVGSDSETAQFSISLQVTGLFRPDPRVNERLCAAAGLEMTGATDEDFTFCGVGEGLATRSFRNWRLLWG
LGAGMPVPEGGGFRIVDDKIVSMAWAREVEAGRALLAYGTDGGEVVIYGVEREEEWKVEELCRFDGRGPHRVVDG
RDPDSMPTGTAFGLRWSPWLEEGGGRRTGILAYLADNYLGFRTVVVEAGELAVTVDAVDAAGLCVFLGFDAFVEW
EDKLWPRGDGWTVRGIVATPMEMQAFEVGINDKCEAAREHTTQQCSTQMPRHNKTNPITGLIIHRPPREKPPSPH
YTLVRLSATAGNTDWYESTRPDTPLPQWAEYISSQTRRTVRRVAAMQGLLDDSDDDDDDDDDDDDEDEDEEEGGG
VNDDNSGLDNSGLDNSGLDNSGLDNSGLDNSGLDNSGLDNSELNNSNNNLTFEETSHTNTANTTTNTTHTTNTAT
KPLPPKNAPLQPPRHPRPNNVPLREGPRLRHLRRQRPRHHEARDFEALRSLRGEVFGRGGARGLWGVWGEVLSLS
VW*
Coding >Ophcf2|03924
ATGGAAAATGCCAATGCGAGCGGCGAAGGCGACGACGAGAAGGCGGATAACAGCAGCCAGAGTCGCAGCAGGAGC
ATCAAGCGCGATAAGCAAAAGTCAGGTTCAAAGCGTCGAGTGCGACCGCTGGAGACGCTTGAACTTCGATTCCGA
CCACTCGCACCTCACGCGATATCGTGGTCATGCGACGCGGAGCTGGCCATCGCGCTAGACGAGGCCATCCACGTC
TTTCTCCCCGAGGTGGGCCCCGTGGGCTCCGACTCGGAGACTGCGCAGTTCTCGATATCGCTGCAGGTTACGGGG
CTGTTCCGACCGGATCCTCGCGTCAACGAGAGGCTCTGCGCGGCGGCGGGCTTGGAGATGACGGGTGCGACGGAC
GAGGACTTCACCTTCTGCGGTGTTGGGGAGGGGCTCGCCACGAGGTCTTTTCGCAACTGGAGGCTTCTTTGGGGA
CTGGGCGCTGGGATGCCCGTTCCCGAGGGGGGAGGGTTTCGGATCGTCGACGATAAGATTGTCTCCATGGCCTGG
GCGAGGGAGGTTGAGGCTGGGAGGGCGCTTCTCGCGTACGGGACTGATGGGGGAGAGGTGGTCATCTATGGCGTT
GAGAGGGAAGAGGAATGGAAGGTCGAGGAGCTTTGTCGGTTCGACGGTCGGGGTCCTCACCGGGTTGTCGACGGA
CGGGACCCGGATTCGATGCCGACGGGCACGGCTTTCGGTCTGCGATGGAGTCCTTGGCTCGAGGAAGGGGGGGGG
AGACGAACGGGGATATTGGCCTACCTTGCTGACAACTACCTTGGCTTCCGGACGGTCGTCGTCGAGGCTGGTGAG
CTGGCGGTCACGGTTGATGCTGTCGACGCGGCGGGCTTGTGTGTCTTTCTCGGCTTTGATGCCTTTGTCGAGTGG
GAGGATAAGTTGTGGCCTCGTGGTGATGGGTGGACGGTTCGGGGGATCGTTGCTACGCCGATGGAGATGCAGGCT
TTCGAGGTAGGGATCAACGACAAGTGTGAAGCTGCGAGGGAACACACGACGCAGCAATGCTCAACTCAGATGCCA
CGCCATAACAAGACGAACCCGATAACCGGTCTCATCATCCACCGTCCGCCTCGAGAAAAGCCCCCTTCACCACAC
TACACCCTCGTCCGCCTCTCCGCCACAGCCGGAAACACAGACTGGTACGAAAGCACCCGCCCAGACACGCCCCTC
CCCCAATGGGCCGAGTACATCTCGTCGCAGACACGACGAACGGTGCGGCGCGTGGCTGCCATGCAGGGCCTGCTA
GACGACTCGGATGACGACGACGACGACGACGACGACGACGACGACGAAGACGAAGACGAGGAGGAGGGCGGGGGC
GTGAACGACGACAACTCGGGACTCGACAACTCGGGACTCGACAACTCGGGGCTCGACAACTCGGGACTCGACAAC
TCGGGACTCGACAACTCGGGACTCGACAACTCGGGACTCGACAACTCGGAACTCAACAACAGCAACAACAACTTG
ACCTTTGAAGAAACCTCACACACCAACACCGCCAACACCACCACCAACACCACCCACACCACCAACACCGCAACT
AAACCCCTCCCCCCCAAGAATGCACCTCTGCAACCACCCCGTCACCCCCGGCCCAACAACGTCCCGCTGCGAGAG
GGGCCACGTCTTCGCCACCTGCGCCGCCAGCGGCCTCGCCATCATGAGGCCCGGGATTTCGAGGCTCTGCGCTCT
TTGCGGGGGGAGGTGTTTGGTCGGGGAGGGGCTCGGGGTCTGTGGGGGGTGTGGGGGGAAGTTTTGAGTCTGTCA
GTGTGGTAG
Transcript >Ophcf2|03924
ATGGAAAATGCCAATGCGAGCGGCGAAGGCGACGACGAGAAGGCGGATAACAGCAGCCAGAGTCGCAGCAGGAGC
ATCAAGCGCGATAAGCAAAAGTCAGGTTCAAAGCGTCGAGTGCGACCGCTGGAGACGCTTGAACTTCGATTCCGA
CCACTCGCACCTCACGCGATATCGTGGTCATGCGACGCGGAGCTGGCCATCGCGCTAGACGAGGCCATCCACGTC
TTTCTCCCCGAGGTGGGCCCCGTGGGCTCCGACTCGGAGACTGCGCAGTTCTCGATATCGCTGCAGGTTACGGGG
CTGTTCCGACCGGATCCTCGCGTCAACGAGAGGCTCTGCGCGGCGGCGGGCTTGGAGATGACGGGTGCGACGGAC
GAGGACTTCACCTTCTGCGGTGTTGGGGAGGGGCTCGCCACGAGGTCTTTTCGCAACTGGAGGCTTCTTTGGGGA
CTGGGCGCTGGGATGCCCGTTCCCGAGGGGGGAGGGTTTCGGATCGTCGACGATAAGATTGTCTCCATGGCCTGG
GCGAGGGAGGTTGAGGCTGGGAGGGCGCTTCTCGCGTACGGGACTGATGGGGGAGAGGTGGTCATCTATGGCGTT
GAGAGGGAAGAGGAATGGAAGGTCGAGGAGCTTTGTCGGTTCGACGGTCGGGGTCCTCACCGGGTTGTCGACGGA
CGGGACCCGGATTCGATGCCGACGGGCACGGCTTTCGGTCTGCGATGGAGTCCTTGGCTCGAGGAAGGGGGGGGG
AGACGAACGGGGATATTGGCCTACCTTGCTGACAACTACCTTGGCTTCCGGACGGTCGTCGTCGAGGCTGGTGAG
CTGGCGGTCACGGTTGATGCTGTCGACGCGGCGGGCTTGTGTGTCTTTCTCGGCTTTGATGCCTTTGTCGAGTGG
GAGGATAAGTTGTGGCCTCGTGGTGATGGGTGGACGGTTCGGGGGATCGTTGCTACGCCGATGGAGATGCAGGCT
TTCGAGGTAGGGATCAACGACAAGTGTGAAGCTGCGAGGGAACACACGACGCAGCAATGCTCAACTCAGATGCCA
CGCCATAACAAGACGAACCCGATAACCGGTCTCATCATCCACCGTCCGCCTCGAGAAAAGCCCCCTTCACCACAC
TACACCCTCGTCCGCCTCTCCGCCACAGCCGGAAACACAGACTGGTACGAAAGCACCCGCCCAGACACGCCCCTC
CCCCAATGGGCCGAGTACATCTCGTCGCAGACACGACGAACGGTGCGGCGCGTGGCTGCCATGCAGGGCCTGCTA
GACGACTCGGATGACGACGACGACGACGACGACGACGACGACGACGAAGACGAAGACGAGGAGGAGGGCGGGGGC
GTGAACGACGACAACTCGGGACTCGACAACTCGGGACTCGACAACTCGGGGCTCGACAACTCGGGACTCGACAAC
TCGGGACTCGACAACTCGGGACTCGACAACTCGGGACTCGACAACTCGGAACTCAACAACAGCAACAACAACTTG
ACCTTTGAAGAAACCTCACACACCAACACCGCCAACACCACCACCAACACCACCCACACCACCAACACCGCAACT
AAACCCCTCCCCCCCAAGAATGCACCTCTGCAACCACCCCGTCACCCCCGGCCCAACAACGTCCCGCTGCGAGAG
GGGCCACGTCTTCGCCACCTGCGCCGCCAGCGGCCTCGCCATCATGAGGCCCGGGATTTCGAGGCTCTGCGCTCT
TTGCGGGGGGAGGTGTTTGGTCGGGGAGGGGCTCGGGGTCTGTGGGGGGTGTGGGGGGAAGTTTTGAGTCTGTCA
GTGTGGTAG
Gene >Ophcf2|03924
ATGGAAAATGCCAATGCGAGCGGCGAAGGCGACGACGAGAAGGCGGATAACAGCAGCCAGAGTCGCAGCAGGAGC
ATCAAGCGCGATAAGCAAAAGTCAGGTTCAAAGCGTCGAGTGCGACCGCTGGAGACGCTTGAACTTCGATTCCGA
CCACTCGCACCTCACGCGATATCGTGGTCATGCGACGCGGAGCTGGCCATCGCGCTAGACGAGGCCATCCACGTC
TTTCTCCCCGAGGTGGGCCCCGTGGGCTCCGACTCGGAGACTGCGCAGTTCTCGATATCGCTGCAGGTTACGGGG
CTGTTCCGACCGGATCCTCGCGTCAACGAGAGGCTCTGCGCGGCGGCGGGCTTGGAGATGACGGGTGCGACGGAC
GAGGACTTCACCTTCTGCGGTGTTGGGGAGGGGCTCGCCACGAGGTCGGGCGCTGCGCTGGGACAGACGGTTCGG
GTTGAGTGGTCGCCTGCTGGGCTGGGATGCTGTCTGCGTCCGGTGCTGGCGGTTCTGACTACTTCTGGGGGGATC
TTCGTCCTTGGCGAGAGGGGGGGAGGTGATGGGGGATGGTGATGACGGGGGCGACGAGGTCTTTTCGCAACTGGA
GGCTTCTTTGGGGACTGGGCGCTGGGATGCCCGTTCCCGAGGGGGGAGGGTTTCGGATCGTCGACGATAAGATTG
TCTCCATGGCCTGGGCGAGGGAGGTTGAGGCTGGGAGGGCGCTTCTCGCGTACGGGACTGATGGGGGAGAGGTGG
TCATCTATGGCGTTGAGAGGGAAGAGGAATGGAAGGTCGAGGAGCTTTGTCGGTTCGACGGTCGGGGTCCTCACC
GGGTTGTCGACGGACGGGACCCGGATTCGATGCCGACGGGCACGGCTTTCGGTCTGCGATGGAGTCCTTGGCTCG
AGGAAGGGGGGGGGAGACGAACGGGGATATTGGCCTACCTTGCTGACAACTACCTTGGCTTCCGGACGGTCGTCG
TCGAGGCTGGTGAGCTGGCGGTCACGGTTGATGCTGTCGACGCGGCGGGCTTGTGTGTCTTTCTCGGCTTTGATG
CCTTTGTCGAGTGGGAGGATAAGGTGAGCTCTTGTTTGTGTTTGTTGAAGGGCTCGGTGAGATGTTGTCGCTGAC
TTTTCGTTTTTTAGTTGTGGCCTCGTGGTGATGGGTGGACGGTTCGGGGGATCGTTGCTACGCCGATGGAGATGC
AGGCTTTCGAGGTAGGGATCAACGACAAGTGTGAAGCTGCGAGGGAACACACGACGCAGCAATGCTCAACTCAGA
TGCCACGCCATAACAAGACGAACCCGATAACCGGTCTCATCATCCACCGTCCGCCTCGAGAAAAGCCCCCTTCAC
CACACTACACCCTCGTCCGCCTCTCCGCCACAGCCGGAAACACAGACTGGTACGAAAGCACCCGCCCAGACACGC
CCCTCCCCCAATGGGCCGAGTACATCTCGTCGCAGACACGACGAACGGTGCGGCGCGTGGCTGCCATGCAGGGCC
TGCTAGACGACTCGGATGACGACGACGACGACGACGACGACGACGACGACGAAGACGAAGACGAGGAGGAGGGCG
GGGGCGTGAAGTTGGCGAGGGTTCATCCCTATAGGTTTCGGCTTTGGGGACTGGCTGCTTCGCCGGGGGGGGGTG
GGAGCGTGGTGCTGGTTTCGAGGGAGGGGTTGTTCATGCGGGGAGGAGGGCGAGGTCGAGGGTTTTGTTTGGGGG
GGGGTGGGGGTTGGGGGGGTCGGGGGGGCTTTCGACGGAGGGGAGGCTCTGGGAGGAGGGCTATGGGGGGTTGGG
CAGCGACGACAACTCGGGACTCGACAACTCGGGACTCGACAACTCGGGGCTCGACAACTCGGGACTCGACAACTC
GGGACTCGACAACTCGGGACTCGACAACTCGGGACTCGACAACTCGGAACTCAACAACAGCAACAACAACTTGAC
CTTTGAAGAAACCTCACACACCAACACCGCCAACACCACCACCAACACCACCCACACCACCAACACCGCAACTAA
ACCCCTCCCCCCCAAGAATGCACCTCTGCAACCACCCCGTCACCCCCGGCCCAACAACGTCCCGCTGCGAGAGGG
GCCACGTCTTCGCCACCTGCGCCGCCAGCGGCCTCGCCATCATGAGGCCCGGGATTTCGAGGCTCTGCGCTCTTT
GCGGGGGGAGGTGTTTGGTCGGGGAGGGGCTCGGGGTCTGTGGGGGGTGTGGGGGGAAGTTTGTGAGTTAGCTGT
CGCTGTCGCTGTCGGTAGCTGTCGCTGTCAGTGAGTCTGTCAGTGTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail