Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03920
Gene name
Locationscaffold_04:365565..366168
Strand+
Gene length (bp)603
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0749 0.0375 0.7277 0.5216 0.1041 0.0133 0.3127 0.17 0.1588 0.0086

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999579

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6115
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03920 (this protein)
Ophiocordyceps kimflemingae Ophio5|8129
Ophiocordyceps subramaniannii Hirsu2|3807
Ophiocordyceps subramaniannii Hirsu2|4242

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03920
MPSFIRCCLAAATMAWTVSSETFRVTATSSNVFSPDTVMAKEGDSIEFHFQAQNHSVVSGIFDNPCTPMPQGSGF
FSGFIYVDDSGEAGHVFRITVNTQEPMPFYSSQAEECPHGMVGIINPSGDKTLDKYRDKAKALARAVSPSGLDFY
GGDLKENSDPSAQRNPDGTAKTVRAAASGQAVPVAALAVAGGLALLAVLS*
Coding >Ophcf2|03920
ATGCCTTCCTTTATCAGATGTTGCCTGGCGGCCGCGACCATGGCCTGGACCGTCAGCAGCGAGACTTTCCGGGTA
ACGGCGACGAGTTCCAACGTCTTCAGCCCGGATACAGTCATGGCCAAGGAGGGAGACTCGATCGAGTTTCACTTC
CAGGCGCAGAATCACAGCGTCGTGTCGGGCATCTTCGACAACCCCTGCACGCCCATGCCACAAGGAAGCGGCTTC
TTCTCCGGCTTCATCTACGTCGACGACAGCGGCGAGGCAGGCCACGTCTTCAGAATAACCGTCAACACGCAAGAG
CCCATGCCCTTCTACTCCTCCCAAGCCGAAGAGTGTCCTCACGGCATGGTGGGCATCATCAACCCCAGCGGCGAC
AAGACGCTCGACAAGTACCGCGATAAGGCCAAGGCGCTTGCCCGCGCCGTCTCGCCGTCGGGACTCGACTTCTAC
GGAGGCGACCTCAAGGAGAATTCGGATCCGAGCGCGCAGCGGAATCCGGACGGTACTGCCAAGACTGTCAGGGCG
GCGGCTTCGGGGCAGGCCGTGCCGGTGGCGGCGTTGGCGGTTGCGGGGGGGCTGGCTTTGCTGGCCGTCTTGTCG
TGA
Transcript >Ophcf2|03920
ATGCCTTCCTTTATCAGATGTTGCCTGGCGGCCGCGACCATGGCCTGGACCGTCAGCAGCGAGACTTTCCGGGTA
ACGGCGACGAGTTCCAACGTCTTCAGCCCGGATACAGTCATGGCCAAGGAGGGAGACTCGATCGAGTTTCACTTC
CAGGCGCAGAATCACAGCGTCGTGTCGGGCATCTTCGACAACCCCTGCACGCCCATGCCACAAGGAAGCGGCTTC
TTCTCCGGCTTCATCTACGTCGACGACAGCGGCGAGGCAGGCCACGTCTTCAGAATAACCGTCAACACGCAAGAG
CCCATGCCCTTCTACTCCTCCCAAGCCGAAGAGTGTCCTCACGGCATGGTGGGCATCATCAACCCCAGCGGCGAC
AAGACGCTCGACAAGTACCGCGATAAGGCCAAGGCGCTTGCCCGCGCCGTCTCGCCGTCGGGACTCGACTTCTAC
GGAGGCGACCTCAAGGAGAATTCGGATCCGAGCGCGCAGCGGAATCCGGACGGTACTGCCAAGACTGTCAGGGCG
GCGGCTTCGGGGCAGGCCGTGCCGGTGGCGGCGTTGGCGGTTGCGGGGGGGCTGGCTTTGCTGGCCGTCTTGTCG
TGA
Gene >Ophcf2|03920
ATGCCTTCCTTTATCAGATGTTGCCTGGCGGCCGCGACCATGGCCTGGACCGTCAGCAGCGAGACTTTCCGGGTA
ACGGCGACGAGTTCCAACGTCTTCAGCCCGGATACAGTCATGGCCAAGGAGGGAGACTCGATCGAGTTTCACTTC
CAGGCGCAGAATCACAGCGTCGTGTCGGGCATCTTCGACAACCCCTGCACGCCCATGCCACAAGGAAGCGGCTTC
TTCTCCGGCTTCATCTACGTCGACGACAGCGGCGAGGCAGGCCACGTCTTCAGAATAACCGTCAACACGCAAGAG
CCCATGCCCTTCTACTCCTCCCAAGCCGAAGAGTGTCCTCACGGCATGGTGGGCATCATCAACCCCAGCGGCGAC
AAGACGCTCGACAAGTACCGCGATAAGGCCAAGGCGCTTGCCCGCGCCGTCTCGCCGTCGGGACTCGACTTCTAC
GGAGGCGACCTCAAGGAGAATTCGGATCCGAGCGCGCAGCGGAATCCGGACGGTACTGCCAAGACTGTCAGGGCG
GCGGCTTCGGGGCAGGCCGTGCCGGTGGCGGCGTTGGCGGTTGCGGGGGGGCTGGCTTTGCTGGCCGTCTTGTCG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail