Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03915
Gene name
Locationscaffold_04:352929..353705
Strand+
Gene length (bp)776
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01243 Putative_PNPOx Pyridoxamine 5'-phosphate oxidase 6.4E-19 82 163

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Plastid Chloroplast transit peptide 0.1341 0.174 0.1496 0.038 0.4883 0.9727 0.0471 0.0567 0.0627 0.1486

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 224.12 129.20 319.04
Alive In ants, during behavior modification 46.85 21.92 71.78
Dead In ants, recently dead 52.20 24.81 79.58

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.639802 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup4797
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1948
Ophiocordyceps australis map64 (Brazil) OphauB2|3904
Ophiocordyceps camponoti-floridani Ophcf2|03915 (this protein)
Ophiocordyceps kimflemingae Ophio5|6935
Ophiocordyceps subramaniannii Hirsu2|10316

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03915
MRTTLTAPPSLLSLSARLSSRRAPPTVSVRMAGSRSGEATERANLISLPPQAEQFTRSTLTRQSLLPSPTDQFRR
WFADASAAVPHAETCVLATAGLPEGNVSARVVYLKEVDAEGGFILYSNWETSRKAADVATNPRVALVFHWEALQR
QVRIEGVATRVSPSRSQAYFDTRVRGSRVGAWASRQSSVLVPEGRGRWEDRAREGGWGRGEEV*
Coding >Ophcf2|03915
ATGCGTACGACTTTGACAGCGCCACCGTCGCTGCTATCGCTATCGGCCCGCCTATCATCGCGCCGCGCACCGCCT
ACCGTCAGCGTCAGAATGGCGGGGAGCCGCAGCGGAGAGGCCACGGAGCGGGCCAATCTCATCTCCCTCCCTCCA
CAGGCAGAGCAATTCACACGCTCCACCTTGACGCGTCAGTCTCTACTACCGAGTCCGACGGATCAGTTCCGGCGC
TGGTTCGCCGACGCGAGCGCGGCGGTGCCCCATGCGGAGACGTGCGTCCTCGCGACGGCGGGGTTGCCGGAGGGG
AACGTCTCGGCGCGGGTGGTTTACCTGAAGGAGGTCGATGCCGAGGGGGGATTCATCCTCTATTCCAACTGGGAG
ACTTCTCGCAAGGCAGCCGACGTGGCGACCAACCCGCGCGTGGCCCTCGTCTTCCACTGGGAAGCCCTGCAGCGA
CAAGTCCGAATCGAGGGGGTGGCGACGCGGGTATCCCCCTCGAGGAGCCAGGCGTATTTCGACACGAGGGTTAGG
GGGTCGAGGGTCGGGGCCTGGGCCAGTAGGCAGAGTAGCGTCTTGGTCCCGGAGGGGAGGGGACGATGGGAGGAT
CGCGCTCGAGAGGGCGGTTGGGGACGTGGAGAGGAGGTTTGA
Transcript >Ophcf2|03915
ATGCGTACGACTTTGACAGCGCCACCGTCGCTGCTATCGCTATCGGCCCGCCTATCATCGCGCCGCGCACCGCCT
ACCGTCAGCGTCAGAATGGCGGGGAGCCGCAGCGGAGAGGCCACGGAGCGGGCCAATCTCATCTCCCTCCCTCCA
CAGGCAGAGCAATTCACACGCTCCACCTTGACGCGTCAGTCTCTACTACCGAGTCCGACGGATCAGTTCCGGCGC
TGGTTCGCCGACGCGAGCGCGGCGGTGCCCCATGCGGAGACGTGCGTCCTCGCGACGGCGGGGTTGCCGGAGGGG
AACGTCTCGGCGCGGGTGGTTTACCTGAAGGAGGTCGATGCCGAGGGGGGATTCATCCTCTATTCCAACTGGGAG
ACTTCTCGCAAGGCAGCCGACGTGGCGACCAACCCGCGCGTGGCCCTCGTCTTCCACTGGGAAGCCCTGCAGCGA
CAAGTCCGAATCGAGGGGGTGGCGACGCGGGTATCCCCCTCGAGGAGCCAGGCGTATTTCGACACGAGGGTTAGG
GGGTCGAGGGTCGGGGCCTGGGCCAGTAGGCAGAGTAGCGTCTTGGTCCCGGAGGGGAGGGGACGATGGGAGGAT
CGCGCTCGAGAGGGCGGTTGGGGACGTGGAGAGGAGGTTTGA
Gene >Ophcf2|03915
ATGCGTACGACTTTGACAGCGCCACCGTCGCTGCTATCGCTATCGGCCCGCCTATCATCGCGCCGCGCACCGCCT
ACCGTCAGCGTCAGAATGGCGGGGAGCCGCAGCGGAGAGGCCACGGAGCGGGCCAATCTCATCTGTGCGTCTGTC
CCATGTTTCCACCAAGCTCGTCTCTCATCCCGAGTCATACGACATACCCTACATACAATATATCCCTACACGCGC
ATGTCATGCTTGCCGGGAACGAGGCCTCGATTGACAGAGATGACGAAGCCCTCCCTCCACAGGCAGAGCAATTCA
CACGCTCCACCTTGACGCGTCAGTCTCTACTACCGAGTCCGACGGATCAGTTCCGGCGCTGGTTCGCCGACGCGA
GCGCGGCGGTGCCCCATGCGGAGACGTGCGTCCTCGCGACGGCGGGGTTGCCGGAGGGGAACGTCTCGGCGCGGG
TGGTTTACCTGAAGGAGGTCGATGCCGAGGGGGGATTCATCCTCTATTCCAACTGGGAGACTTCTCGCAAGGCAG
CCGACGTGGCGACCAACCCGCGCGTGGCCCTCGTCTTCCACTGGGAAGCCCTGCAGCGACAAGTCCGAATCGAGG
GGGTGGCGACGCGGGTATCCCCCTCGAGGAGCCAGGCGTATTTCGACACGAGGGTTAGGGGGTCGAGGGTCGGGG
CCTGGGCCAGTAGGCAGAGTAGCGTCTTGGTCCCGGAGGGGAGGGGACGATGGGAGGATCGCGCTCGAGAGGGCG
GTTGGGGACGTGGAGAGGAGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail