Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03914
Gene name
Locationscaffold_04:346880..352637
Strand+
Gene length (bp)5757
Transcript length (bp)5634
Coding sequence length (bp)5634
Protein length (aa) 1878

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 2.0E-82 560 763
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 3.4E-26 1097 1294
PF00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain 5.1E-46 24 162
PF00117 GATase Glutamine amidotransferase class-I 1.1E-42 233 406
PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 5.6E-42 1576 1716
PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 7.7E-31 1722 1872
PF02787 CPSase_L_D3 Carbamoyl-phosphate synthetase large chain, oligomerisation domain 3.6E-25 848 929
PF02142 MGS MGS-like domain 1.6E-22 1377 1474
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 1.1E-05 587 731
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 1.0E-06 1121 1265
PF02222 ATP-grasp ATP-grasp domain 4.6E-07 1106 1267

GO

GO Term Description Terminal node
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0005524 ATP binding Yes
GO:0016597 amino acid binding Yes
GO:0016743 carboxyl- or carbamoyltransferase activity Yes
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0043177 organic acid binding No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0016881 acid-amino acid ligase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006082 organic acid metabolic process No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016874 ligase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6721 0.3359 0.1043 0.1437 0.3551 0.0569 0.1196 0.177 0.2211 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup176
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|267
Ophiocordyceps australis 1348a (Ghana) OphauG2|361
Ophiocordyceps australis map64 (Brazil) OphauB2|4801
Ophiocordyceps australis map64 (Brazil) OphauB2|5027
Ophiocordyceps camponoti-floridani Ophcf2|03914 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04560
Ophiocordyceps camponoti-rufipedis Ophun1|6480
Ophiocordyceps camponoti-rufipedis Ophun1|7566
Ophiocordyceps kimflemingae Ophio5|6934
Ophiocordyceps kimflemingae Ophio5|7435
Ophiocordyceps subramaniannii Hirsu2|258
Ophiocordyceps subramaniannii Hirsu2|472

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03914
MAAAALPPASARMASVPDEGLICLELADGSALQGYSFGSASSIAGELVFQTGMVGYPESLTDPSYRGQILVLTFP
LVGNYGVPSRDAVDGDVATGLPAYVESAEIHVAGLVVASYCGSDFSHFLAQSSLGEWLKERHVPAMYGVDTRALT
KKIRRQGSMLGRMRLQAGVVANGVEGGVASAPLRHFAAVEWADPNKQNLVAQVSIDAPKLYSPPPSVAVRSHPSG
RPVRILCVDVGIKYNQLRCFLRRGVEVLVCPWDHRLASADYDGLFVSNGPGDPALLDVTVANLAAAMERNRTPVF
GICLGHQLLARAAGAATTKMKFGNRGQNIPCTSMVTGKCHITSQNHGFAVDARSLPVDWVELFVNANDGSNEGIM
HRHRPYFSVQFHPESAPGPRDTEFLFDVFLDAVVACARRPALLQRPVEFPGGSAEENQRLHPRVSVTKALVLGSG
GLSIGQAGEFDYSGSQAIKALKEEGIYTVLINPNIATIQTSKGLADKVYFLPVNADFVRKVIHYERPDAIYVTFG
GQTALQVGIQLKDEFEGLGVRVLGTPIDTIITTEDRELFARSIESIGEKCAKSASACNVDEALEVVKDIGFPVIV
RAAYALGGLGSGFANDERELLELCHKAFAASPQVLIERSMKGWKEIEYEVVRDAQDNCITVCNMENFDPLGIHTG
DSIVVAPSQTLSDQDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSREYCIIEVNARLSRSSALASKATGFPLAF
IAAKLGLGIPLKEVSNSVTKVTCACFEPSLDYVVVKMPRWDLNKFTRVSTQLGSSMKSVGEVMSIGRSFEEAIQK
AIRAIDYHNLGFGPTKALMSIDDELQTPSDQRLFAIANAMHEGYSVDKIWDMTKIDKWFLRKLKGLSDFAKDMMA
MAGRGARAPHVMLEAKRLGFSDRQLARFWDSNEIAVRRQRQEAGIRPWVKQIDTVAAEFPAMTNYLYMTYNASEH
DVPFDDHGLMVLGSGVYRIGSSVEFDWCSVRAIRTLRSSGYKTVMVNFNPETVSTDYDEADRLYFENINLETVLD
IYQLEGAGGVLGAMGGQTPNNIALPLHRAGVRMLGTSPEMIDMAENRYKFSRMLDRIEVDQPTWRELTSFDEASD
FCKAVGYPVLVRPSYVLSGAAMNTVYSEKDLVNYLAQAADVSREHPVVISKYIENAKEIEMDAVARDGLVVGHFI
SEHVENAGVHSGDATLILPPQDLEPTTIARIEEATRKIGAALNVTGPFNIQFIAKDNDIKVIECNVRASRSFPFV
SKVMGVDLIEMATKAIVGLPFAAHPPTTLAADCVAVKVPQFSFSRLSGADPVLGVEMASTGEVACFGVDKYEAYL
KALLSTGFRVPKANVLLSIGSYKDKREMLPWVQKLQRIGYKLFATAGTADFLQEHGVQVQFLEVLGRDEDMESEF
SLTQHLSKNTIDLYINLPSNNKYRRPANYMSKGYKTRRMAVDYQIPLVTNVKNAKILVEAIARHVYLDVSKRDYQ
LTGEQEEAAAAAAAGASTRPGMMPTTRTDDGVTAAAASMTKTTKTTAAAASATCEDAISASVMQLLAQPSCFHKA
NVLSVEQYTRADLHLLFTVAQEMRLGVQREGVLNLLRGKVLCTLFYEPSTRTSASFDAAMQRLGGRTVAVAASRS
SAQKGETLRDTLRTLACYGDAIVLRHPDESSVDEAERYGDVPIINAGNGSGEHPTQAFLDLFTIREELGTVQGLT
VTFVGDLRHGRTVHSLVRLLRHYQVKVQLVAPAGLELPSAAREQLAASGQLLCESSSLTAEVTARSDVLYCTRVQ
RERFASEEQYEAVRSSYRVDNAVLKHAKGSMVVMHPLPRNDEVADEVDFDQRAAYFRQMRYGLYCRMALLALVMA
GP*
Coding >Ophcf2|03914
ATGGCCGCAGCCGCACTCCCCCCGGCGTCGGCGCGCATGGCCAGCGTCCCCGACGAGGGCCTCATCTGCCTCGAG
CTCGCCGACGGCTCGGCTCTACAGGGCTACAGCTTCGGTTCTGCCTCCAGCATCGCGGGCGAACTCGTCTTTCAA
ACGGGAATGGTCGGCTACCCCGAATCCCTCACGGATCCGTCCTACCGCGGCCAGATTCTGGTCCTCACCTTTCCG
CTCGTCGGCAACTACGGCGTCCCTTCGCGGGATGCTGTCGATGGGGATGTGGCGACTGGGTTGCCTGCGTATGTC
GAGTCTGCCGAGATTCATGTCGCTGGTCTCGTCGTTGCTTCGTACTGCGGTTCGGACTTTTCGCACTTTTTGGCG
CAGTCTTCGTTGGGGGAGTGGCTGAAGGAGCGGCATGTGCCGGCCATGTATGGCGTTGATACCAGGGCCTTAACC
AAGAAGATTCGGAGGCAGGGGAGTATGCTTGGGCGCATGAGGCTACAGGCTGGCGTTGTGGCCAACGGCGTCGAG
GGCGGTGTTGCTTCGGCGCCGTTGCGTCACTTTGCCGCCGTTGAATGGGCTGATCCCAACAAGCAGAATCTCGTT
GCTCAGGTCTCCATCGACGCCCCGAAGCTCTACTCTCCACCGCCGTCAGTCGCCGTCCGCTCTCATCCGTCCGGC
CGTCCCGTTCGAATCCTCTGCGTCGACGTGGGCATCAAGTATAATCAGCTTCGATGCTTCCTTCGCCGTGGCGTC
GAGGTCCTCGTCTGTCCCTGGGACCACAGGCTGGCCTCTGCCGATTATGACGGCCTCTTCGTCTCCAACGGCCCT
GGAGATCCGGCTCTTCTCGACGTCACCGTCGCCAACCTCGCGGCTGCCATGGAGCGCAACAGGACGCCCGTCTTC
GGTATCTGCCTCGGCCACCAGCTCCTCGCCAGGGCTGCCGGCGCTGCCACAACAAAGATGAAGTTTGGGAACCGC
GGGCAGAATATCCCCTGCACCAGCATGGTGACGGGAAAGTGCCACATCACGTCGCAGAATCATGGTTTCGCCGTT
GATGCTCGCTCTCTGCCCGTCGACTGGGTCGAGCTCTTTGTCAACGCAAACGACGGCAGCAATGAGGGCATCATG
CACCGTCACCGGCCCTACTTCAGCGTCCAGTTCCACCCGGAGAGCGCGCCCGGCCCGCGCGATACCGAGTTTCTC
TTCGACGTCTTCCTCGACGCTGTCGTCGCCTGCGCGCGGCGGCCCGCTCTCCTGCAGAGGCCCGTCGAGTTCCCC
GGTGGCTCTGCCGAAGAAAACCAGAGACTACACCCGCGCGTCTCCGTCACAAAGGCTCTCGTCCTCGGCAGCGGC
GGCCTCAGTATCGGTCAGGCCGGAGAGTTTGACTACTCCGGCAGCCAGGCCATCAAGGCGCTCAAGGAGGAGGGC
ATCTACACCGTCCTCATCAACCCCAACATCGCCACCATCCAGACGTCAAAGGGCCTCGCCGACAAGGTCTACTTT
CTGCCCGTCAACGCCGACTTTGTTCGCAAGGTCATCCACTACGAGCGCCCGGACGCCATCTACGTCACCTTTGGC
GGCCAGACGGCCCTGCAGGTGGGGATCCAGCTCAAGGACGAGTTCGAGGGCCTCGGTGTCCGCGTCCTGGGCACG
CCCATCGACACCATCATCACGACCGAGGATCGTGAGCTCTTTGCGCGCAGCATCGAGTCCATTGGCGAAAAGTGC
GCCAAGTCGGCCTCGGCCTGCAACGTCGACGAGGCGCTCGAGGTCGTCAAGGACATCGGCTTCCCCGTCATCGTC
CGCGCTGCCTACGCGCTCGGCGGTCTGGGCAGCGGCTTTGCCAATGACGAGCGCGAGCTGCTCGAGCTGTGTCAC
AAGGCCTTTGCCGCCAGCCCTCAGGTGCTCATCGAGCGCAGCATGAAGGGTTGGAAGGAGATTGAGTACGAAGTC
GTCCGCGACGCTCAGGACAACTGCATCACCGTCTGCAACATGGAGAACTTTGACCCGCTCGGAATCCACACGGGA
GACTCCATCGTCGTCGCCCCCTCGCAGACGCTGTCGGATCAAGACTACAACATGCTGCGGACGACGGCCGTCAAC
GTCATCCGTCACCTCGGCGTCGTCGGCGAGTGCAACATCCAGTACGCCCTCAACCCCTTCTCTAGGGAGTACTGC
ATCATCGAGGTCAACGCGCGCCTATCGCGGTCGTCGGCGTTGGCCTCCAAGGCGACCGGCTTCCCGTTGGCTTTC
ATCGCCGCGAAGCTCGGGCTCGGCATCCCCCTGAAGGAGGTATCCAACTCGGTGACCAAGGTGACGTGCGCGTGC
TTCGAGCCCTCGCTCGATTACGTCGTCGTCAAGATGCCGCGCTGGGATCTCAACAAGTTCACGCGCGTCTCGACC
CAGCTCGGATCGTCGATGAAGAGCGTGGGCGAGGTCATGAGCATCGGCCGCTCGTTCGAAGAGGCCATTCAGAAG
GCGATCCGGGCCATCGACTACCACAACCTCGGCTTCGGCCCTACCAAGGCGCTCATGAGTATCGACGACGAGCTG
CAGACGCCGTCGGACCAGCGGCTGTTCGCCATCGCCAACGCCATGCACGAGGGCTACTCGGTCGACAAGATCTGG
GACATGACCAAGATCGACAAGTGGTTCCTGCGCAAGCTCAAGGGCCTCAGCGACTTTGCCAAGGACATGATGGCC
ATGGCCGGCCGGGGCGCGCGCGCGCCGCACGTCATGCTCGAGGCCAAGCGGCTCGGCTTCAGCGACCGGCAGCTG
GCTCGCTTCTGGGACTCCAACGAGATCGCGGTCCGGCGGCAGCGGCAGGAGGCCGGCATCCGTCCGTGGGTCAAG
CAGATCGATACCGTCGCGGCCGAGTTCCCGGCCATGACCAATTACCTGTACATGACGTACAACGCGAGCGAGCAC
GACGTGCCGTTCGACGACCACGGGCTCATGGTGCTGGGCTCGGGCGTGTACCGGATCGGGTCTTCGGTCGAGTTC
GACTGGTGCTCGGTACGGGCGATCCGGACGCTACGCTCATCGGGCTACAAGACGGTCATGGTCAACTTCAACCCG
GAGACGGTCAGCACCGACTACGACGAGGCGGACCGGCTATACTTTGAGAACATCAACCTGGAGACCGTCCTCGAC
ATCTACCAGCTCGAGGGCGCGGGCGGCGTGCTGGGCGCCATGGGCGGGCAGACGCCCAACAACATCGCGCTGCCT
CTGCACCGGGCCGGCGTGCGCATGCTGGGCACTTCGCCCGAGATGATCGACATGGCGGAGAACCGGTACAAGTTC
TCGCGCATGCTGGACAGGATCGAGGTCGATCAGCCGACGTGGCGCGAGCTGACGAGCTTCGACGAGGCCAGCGAC
TTTTGCAAGGCCGTCGGCTACCCGGTCCTCGTCCGGCCGTCGTATGTTCTGTCGGGCGCGGCCATGAACACGGTC
TACTCGGAGAAGGACCTGGTCAACTACCTGGCGCAGGCGGCCGACGTCTCGCGCGAGCATCCCGTCGTCATCTCC
AAGTATATCGAGAACGCCAAGGAGATCGAGATGGACGCCGTGGCTCGCGACGGGCTGGTCGTCGGTCACTTCATC
TCGGAGCACGTGGAGAACGCCGGGGTGCACTCGGGCGACGCGACGCTGATCCTGCCGCCGCAGGACCTGGAGCCG
ACGACGATTGCGCGCATCGAGGAGGCGACGCGCAAGATCGGCGCGGCCCTCAACGTGACGGGACCCTTTAACATT
CAGTTCATCGCAAAGGACAACGACATCAAGGTCATCGAATGCAACGTACGGGCGTCGCGGTCCTTTCCCTTTGTG
TCAAAGGTCATGGGCGTCGACCTGATCGAGATGGCAACCAAGGCCATCGTCGGCCTGCCCTTTGCCGCCCACCCG
CCGACGACGCTGGCGGCCGACTGCGTGGCCGTCAAGGTGCCGCAGTTCAGCTTCTCGCGCCTGTCCGGGGCCGAT
CCGGTGCTGGGCGTCGAGATGGCGTCGACGGGCGAGGTGGCCTGCTTCGGAGTCGACAAGTACGAGGCCTACCTC
AAGGCGCTGCTCTCGACGGGCTTCCGCGTGCCCAAGGCCAACGTGCTGCTGTCCATCGGCTCCTACAAGGACAAG
CGGGAGATGCTGCCTTGGGTGCAGAAGCTTCAGCGCATCGGCTACAAGCTGTTCGCCACGGCCGGCACCGCCGAC
TTCTTGCAGGAGCACGGCGTGCAGGTGCAGTTCCTCGAGGTGCTGGGGCGCGACGAGGACATGGAGTCGGAGTTC
TCCCTGACGCAGCATCTGTCCAAGAACACCATCGACCTGTACATCAACCTGCCGTCCAACAACAAGTACCGGCGG
CCGGCCAACTACATGAGCAAGGGGTACAAGACGAGGCGCATGGCGGTCGACTACCAGATCCCGCTGGTGACCAAC
GTCAAGAACGCAAAGATCCTGGTCGAGGCCATCGCCCGGCACGTGTACCTGGACGTGTCGAAGCGAGACTACCAG
TTGACGGGCGAGCAGGAGGAGGCGGCGGCGGCGGCGGCGGCGGGTGCTTCGACGAGGCCCGGGATGATGCCGACG
ACGCGGACCGACGACGGCGTGACGGCGGCGGCGGCATCGATGACGAAGACGACGAAGACGACGGCGGCGGCGGCA
TCGGCGACGTGCGAAGACGCCATCAGCGCATCCGTCATGCAGCTCCTCGCCCAGCCGTCGTGCTTCCACAAGGCC
AACGTGCTGTCGGTGGAGCAGTACACGAGGGCCGACCTCCACCTGCTGTTCACGGTGGCACAGGAGATGCGACTC
GGGGTGCAGCGCGAGGGCGTGCTCAACCTGCTACGGGGCAAGGTGCTGTGCACGCTCTTCTACGAGCCGTCGACG
CGGACGTCGGCCTCGTTCGACGCGGCCATGCAGCGGCTCGGGGGCCGGACGGTGGCGGTGGCGGCGTCGCGGTCG
TCGGCGCAAAAGGGCGAGACGCTGCGGGACACGCTCCGGACGCTGGCATGCTACGGCGACGCCATCGTGCTCCGA
CACCCGGACGAGTCGTCGGTGGACGAGGCGGAGCGGTACGGCGACGTGCCCATCATCAACGCGGGCAACGGCAGC
GGCGAGCACCCGACGCAGGCCTTCCTCGACCTCTTCACCATCCGCGAGGAGCTGGGGACGGTGCAGGGCCTGACG
GTGACCTTCGTGGGGGACCTGCGGCACGGGCGGACGGTGCACTCGCTGGTACGGCTGCTGCGGCACTATCAGGTC
AAGGTGCAGCTGGTGGCGCCGGCCGGGCTGGAGCTCCCGTCGGCGGCGCGGGAGCAGCTGGCGGCATCGGGACAG
CTCCTCTGCGAGTCGTCGTCGCTGACGGCCGAGGTGACGGCCCGGAGCGACGTGCTGTACTGCACGAGGGTGCAG
CGGGAGCGGTTCGCTTCGGAGGAGCAGTACGAGGCGGTGCGCAGCTCGTACCGGGTGGACAACGCGGTGCTCAAG
CACGCCAAGGGGTCCATGGTGGTGATGCATCCGCTTCCGCGCAACGACGAGGTGGCGGACGAGGTCGACTTTGAC
CAGCGGGCGGCCTATTTCCGACAGATGCGGTATGGGCTTTACTGCCGGATGGCGCTGTTGGCGCTTGTGATGGCG
GGGCCTTGA
Transcript >Ophcf2|03914
ATGGCCGCAGCCGCACTCCCCCCGGCGTCGGCGCGCATGGCCAGCGTCCCCGACGAGGGCCTCATCTGCCTCGAG
CTCGCCGACGGCTCGGCTCTACAGGGCTACAGCTTCGGTTCTGCCTCCAGCATCGCGGGCGAACTCGTCTTTCAA
ACGGGAATGGTCGGCTACCCCGAATCCCTCACGGATCCGTCCTACCGCGGCCAGATTCTGGTCCTCACCTTTCCG
CTCGTCGGCAACTACGGCGTCCCTTCGCGGGATGCTGTCGATGGGGATGTGGCGACTGGGTTGCCTGCGTATGTC
GAGTCTGCCGAGATTCATGTCGCTGGTCTCGTCGTTGCTTCGTACTGCGGTTCGGACTTTTCGCACTTTTTGGCG
CAGTCTTCGTTGGGGGAGTGGCTGAAGGAGCGGCATGTGCCGGCCATGTATGGCGTTGATACCAGGGCCTTAACC
AAGAAGATTCGGAGGCAGGGGAGTATGCTTGGGCGCATGAGGCTACAGGCTGGCGTTGTGGCCAACGGCGTCGAG
GGCGGTGTTGCTTCGGCGCCGTTGCGTCACTTTGCCGCCGTTGAATGGGCTGATCCCAACAAGCAGAATCTCGTT
GCTCAGGTCTCCATCGACGCCCCGAAGCTCTACTCTCCACCGCCGTCAGTCGCCGTCCGCTCTCATCCGTCCGGC
CGTCCCGTTCGAATCCTCTGCGTCGACGTGGGCATCAAGTATAATCAGCTTCGATGCTTCCTTCGCCGTGGCGTC
GAGGTCCTCGTCTGTCCCTGGGACCACAGGCTGGCCTCTGCCGATTATGACGGCCTCTTCGTCTCCAACGGCCCT
GGAGATCCGGCTCTTCTCGACGTCACCGTCGCCAACCTCGCGGCTGCCATGGAGCGCAACAGGACGCCCGTCTTC
GGTATCTGCCTCGGCCACCAGCTCCTCGCCAGGGCTGCCGGCGCTGCCACAACAAAGATGAAGTTTGGGAACCGC
GGGCAGAATATCCCCTGCACCAGCATGGTGACGGGAAAGTGCCACATCACGTCGCAGAATCATGGTTTCGCCGTT
GATGCTCGCTCTCTGCCCGTCGACTGGGTCGAGCTCTTTGTCAACGCAAACGACGGCAGCAATGAGGGCATCATG
CACCGTCACCGGCCCTACTTCAGCGTCCAGTTCCACCCGGAGAGCGCGCCCGGCCCGCGCGATACCGAGTTTCTC
TTCGACGTCTTCCTCGACGCTGTCGTCGCCTGCGCGCGGCGGCCCGCTCTCCTGCAGAGGCCCGTCGAGTTCCCC
GGTGGCTCTGCCGAAGAAAACCAGAGACTACACCCGCGCGTCTCCGTCACAAAGGCTCTCGTCCTCGGCAGCGGC
GGCCTCAGTATCGGTCAGGCCGGAGAGTTTGACTACTCCGGCAGCCAGGCCATCAAGGCGCTCAAGGAGGAGGGC
ATCTACACCGTCCTCATCAACCCCAACATCGCCACCATCCAGACGTCAAAGGGCCTCGCCGACAAGGTCTACTTT
CTGCCCGTCAACGCCGACTTTGTTCGCAAGGTCATCCACTACGAGCGCCCGGACGCCATCTACGTCACCTTTGGC
GGCCAGACGGCCCTGCAGGTGGGGATCCAGCTCAAGGACGAGTTCGAGGGCCTCGGTGTCCGCGTCCTGGGCACG
CCCATCGACACCATCATCACGACCGAGGATCGTGAGCTCTTTGCGCGCAGCATCGAGTCCATTGGCGAAAAGTGC
GCCAAGTCGGCCTCGGCCTGCAACGTCGACGAGGCGCTCGAGGTCGTCAAGGACATCGGCTTCCCCGTCATCGTC
CGCGCTGCCTACGCGCTCGGCGGTCTGGGCAGCGGCTTTGCCAATGACGAGCGCGAGCTGCTCGAGCTGTGTCAC
AAGGCCTTTGCCGCCAGCCCTCAGGTGCTCATCGAGCGCAGCATGAAGGGTTGGAAGGAGATTGAGTACGAAGTC
GTCCGCGACGCTCAGGACAACTGCATCACCGTCTGCAACATGGAGAACTTTGACCCGCTCGGAATCCACACGGGA
GACTCCATCGTCGTCGCCCCCTCGCAGACGCTGTCGGATCAAGACTACAACATGCTGCGGACGACGGCCGTCAAC
GTCATCCGTCACCTCGGCGTCGTCGGCGAGTGCAACATCCAGTACGCCCTCAACCCCTTCTCTAGGGAGTACTGC
ATCATCGAGGTCAACGCGCGCCTATCGCGGTCGTCGGCGTTGGCCTCCAAGGCGACCGGCTTCCCGTTGGCTTTC
ATCGCCGCGAAGCTCGGGCTCGGCATCCCCCTGAAGGAGGTATCCAACTCGGTGACCAAGGTGACGTGCGCGTGC
TTCGAGCCCTCGCTCGATTACGTCGTCGTCAAGATGCCGCGCTGGGATCTCAACAAGTTCACGCGCGTCTCGACC
CAGCTCGGATCGTCGATGAAGAGCGTGGGCGAGGTCATGAGCATCGGCCGCTCGTTCGAAGAGGCCATTCAGAAG
GCGATCCGGGCCATCGACTACCACAACCTCGGCTTCGGCCCTACCAAGGCGCTCATGAGTATCGACGACGAGCTG
CAGACGCCGTCGGACCAGCGGCTGTTCGCCATCGCCAACGCCATGCACGAGGGCTACTCGGTCGACAAGATCTGG
GACATGACCAAGATCGACAAGTGGTTCCTGCGCAAGCTCAAGGGCCTCAGCGACTTTGCCAAGGACATGATGGCC
ATGGCCGGCCGGGGCGCGCGCGCGCCGCACGTCATGCTCGAGGCCAAGCGGCTCGGCTTCAGCGACCGGCAGCTG
GCTCGCTTCTGGGACTCCAACGAGATCGCGGTCCGGCGGCAGCGGCAGGAGGCCGGCATCCGTCCGTGGGTCAAG
CAGATCGATACCGTCGCGGCCGAGTTCCCGGCCATGACCAATTACCTGTACATGACGTACAACGCGAGCGAGCAC
GACGTGCCGTTCGACGACCACGGGCTCATGGTGCTGGGCTCGGGCGTGTACCGGATCGGGTCTTCGGTCGAGTTC
GACTGGTGCTCGGTACGGGCGATCCGGACGCTACGCTCATCGGGCTACAAGACGGTCATGGTCAACTTCAACCCG
GAGACGGTCAGCACCGACTACGACGAGGCGGACCGGCTATACTTTGAGAACATCAACCTGGAGACCGTCCTCGAC
ATCTACCAGCTCGAGGGCGCGGGCGGCGTGCTGGGCGCCATGGGCGGGCAGACGCCCAACAACATCGCGCTGCCT
CTGCACCGGGCCGGCGTGCGCATGCTGGGCACTTCGCCCGAGATGATCGACATGGCGGAGAACCGGTACAAGTTC
TCGCGCATGCTGGACAGGATCGAGGTCGATCAGCCGACGTGGCGCGAGCTGACGAGCTTCGACGAGGCCAGCGAC
TTTTGCAAGGCCGTCGGCTACCCGGTCCTCGTCCGGCCGTCGTATGTTCTGTCGGGCGCGGCCATGAACACGGTC
TACTCGGAGAAGGACCTGGTCAACTACCTGGCGCAGGCGGCCGACGTCTCGCGCGAGCATCCCGTCGTCATCTCC
AAGTATATCGAGAACGCCAAGGAGATCGAGATGGACGCCGTGGCTCGCGACGGGCTGGTCGTCGGTCACTTCATC
TCGGAGCACGTGGAGAACGCCGGGGTGCACTCGGGCGACGCGACGCTGATCCTGCCGCCGCAGGACCTGGAGCCG
ACGACGATTGCGCGCATCGAGGAGGCGACGCGCAAGATCGGCGCGGCCCTCAACGTGACGGGACCCTTTAACATT
CAGTTCATCGCAAAGGACAACGACATCAAGGTCATCGAATGCAACGTACGGGCGTCGCGGTCCTTTCCCTTTGTG
TCAAAGGTCATGGGCGTCGACCTGATCGAGATGGCAACCAAGGCCATCGTCGGCCTGCCCTTTGCCGCCCACCCG
CCGACGACGCTGGCGGCCGACTGCGTGGCCGTCAAGGTGCCGCAGTTCAGCTTCTCGCGCCTGTCCGGGGCCGAT
CCGGTGCTGGGCGTCGAGATGGCGTCGACGGGCGAGGTGGCCTGCTTCGGAGTCGACAAGTACGAGGCCTACCTC
AAGGCGCTGCTCTCGACGGGCTTCCGCGTGCCCAAGGCCAACGTGCTGCTGTCCATCGGCTCCTACAAGGACAAG
CGGGAGATGCTGCCTTGGGTGCAGAAGCTTCAGCGCATCGGCTACAAGCTGTTCGCCACGGCCGGCACCGCCGAC
TTCTTGCAGGAGCACGGCGTGCAGGTGCAGTTCCTCGAGGTGCTGGGGCGCGACGAGGACATGGAGTCGGAGTTC
TCCCTGACGCAGCATCTGTCCAAGAACACCATCGACCTGTACATCAACCTGCCGTCCAACAACAAGTACCGGCGG
CCGGCCAACTACATGAGCAAGGGGTACAAGACGAGGCGCATGGCGGTCGACTACCAGATCCCGCTGGTGACCAAC
GTCAAGAACGCAAAGATCCTGGTCGAGGCCATCGCCCGGCACGTGTACCTGGACGTGTCGAAGCGAGACTACCAG
TTGACGGGCGAGCAGGAGGAGGCGGCGGCGGCGGCGGCGGCGGGTGCTTCGACGAGGCCCGGGATGATGCCGACG
ACGCGGACCGACGACGGCGTGACGGCGGCGGCGGCATCGATGACGAAGACGACGAAGACGACGGCGGCGGCGGCA
TCGGCGACGTGCGAAGACGCCATCAGCGCATCCGTCATGCAGCTCCTCGCCCAGCCGTCGTGCTTCCACAAGGCC
AACGTGCTGTCGGTGGAGCAGTACACGAGGGCCGACCTCCACCTGCTGTTCACGGTGGCACAGGAGATGCGACTC
GGGGTGCAGCGCGAGGGCGTGCTCAACCTGCTACGGGGCAAGGTGCTGTGCACGCTCTTCTACGAGCCGTCGACG
CGGACGTCGGCCTCGTTCGACGCGGCCATGCAGCGGCTCGGGGGCCGGACGGTGGCGGTGGCGGCGTCGCGGTCG
TCGGCGCAAAAGGGCGAGACGCTGCGGGACACGCTCCGGACGCTGGCATGCTACGGCGACGCCATCGTGCTCCGA
CACCCGGACGAGTCGTCGGTGGACGAGGCGGAGCGGTACGGCGACGTGCCCATCATCAACGCGGGCAACGGCAGC
GGCGAGCACCCGACGCAGGCCTTCCTCGACCTCTTCACCATCCGCGAGGAGCTGGGGACGGTGCAGGGCCTGACG
GTGACCTTCGTGGGGGACCTGCGGCACGGGCGGACGGTGCACTCGCTGGTACGGCTGCTGCGGCACTATCAGGTC
AAGGTGCAGCTGGTGGCGCCGGCCGGGCTGGAGCTCCCGTCGGCGGCGCGGGAGCAGCTGGCGGCATCGGGACAG
CTCCTCTGCGAGTCGTCGTCGCTGACGGCCGAGGTGACGGCCCGGAGCGACGTGCTGTACTGCACGAGGGTGCAG
CGGGAGCGGTTCGCTTCGGAGGAGCAGTACGAGGCGGTGCGCAGCTCGTACCGGGTGGACAACGCGGTGCTCAAG
CACGCCAAGGGGTCCATGGTGGTGATGCATCCGCTTCCGCGCAACGACGAGGTGGCGGACGAGGTCGACTTTGAC
CAGCGGGCGGCCTATTTCCGACAGATGCGGTATGGGCTTTACTGCCGGATGGCGCTGTTGGCGCTTGTGATGGCG
GGGCCTTGA
Gene >Ophcf2|03914
ATGGCCGCAGCCGCACTCCCCCCGGCGTCGGCGCGCATGGCCAGCGTCCCCGACGAGGGCCTCATCTGCCTCGAG
CTCGCCGACGGCTCGGCTCTACAGGGCTACAGCTTCGGTTCTGCCTCCAGCATCGCGGGCGAACTCGTCTTTCAA
ACGGGAATGGTCGGCTACCCCGAATCCCTCACGGATCCGTCCTACCGCGGCCAGATTCTGGTCCTCACCTTTCCG
CTCGTCGGCAACTACGGCGTCCCTTCGCGGGATGCTGTCGATGGGGATGTGGCGACTGGGTTGCCTGCGTATGTC
GAGTCTGCCGAGATTCATGTCGCTGGTCTCGTCGTTGCTTCGTACTGCGGTTCGGACTTTTCGCACTTTTTGGCG
CAGTCTTCGTTGGGGGAGTGGCTGAAGGAGCGGCATGTGCCGGCCATGTATGGCGTTGATACCAGGGCCTTAACC
AAGAAGATTCGGAGGCAGGGGAGTATGCTTGGGCGCATGAGGCTACAGGCTGGCGTTGTGGCCAACGGCGTCGAG
GGCGGTGTTGCTTCGGCGCCGTTGCGTCACTTTGCCGCCGTTGAATGGGCTGATCCCAACAAGCAGAATCTCGTT
GCTCAGGGTTCCGTCTTCCTCTCCTCGTGAAAGAGGATTCGTGTTGCTGACGGTGTTGATAGTCTCCATCGACGC
CCCGAAGCTCTACTCTCCACCGCCGTCAGTCGCCGTCCGCTCTCATCCGTCCGGCCGTCCCGTTCGAATCCTCTG
CGTCGACGTGGGCATCAAGTATAATCAGCTTCGATGCTTCCTTCGCCGTGGCGTCGAGGTCCTCGTCTGTCCCTG
GGACCACAGGCTGGCCTCTGCCGATTATGACGGCCTCTTCGTCTCCAACGGCCCTGGAGATCCGGCTCTTCTCGA
CGTCACCGTCGCCAACCTCGCGGCTGCCATGGAGCGCAACAGGACGCCCGTCTTCGGTATCTGCCTCGGCCACCA
GCTCCTCGCCAGGGCTGCCGGCGCTGCCACAACAAAGATGAAGTTTGGGAACCGCGGGCAGAATATCCCCTGCAC
CAGCATGGTGACGGGAAAGTGCCACATCACGTCGCAGAATCATGGTTTCGCCGTTGATGCTCGCTCTCTGCCCGT
CGACTGGGTCGAGCTCTTTGTCAACGCAAACGACGGCAGCAATGAGGGCATCATGCACCGTCACCGGCCCTACTT
CAGCGTCCAGTTCCACCCGGAGAGCGCGCCCGGCCCGCGCGATACCGAGTTTCTCTTCGACGTCTTCCTCGACGC
TGTCGTCGCCTGCGCGCGGCGGCCCGCTCTCCTGCAGAGGCCCGTCGAGTTCCCCGGTGGCTCTGCCGAAGAAAA
CCAGAGACTACACCCGCGCGTCTCCGTCACAAAGGCTCTCGTCCTCGGCAGCGGCGGCCTCAGTATCGGTCAGGC
CGGAGAGTTTGACTACTCCGGCAGCCAGGCCATCAAGGCGCTCAAGGAGGAGGGCATCTACACCGTCCTCATCAA
CCCCAACATCGCCACCATCCAGACGTCAAAGGGCCTCGCCGACAAGGTCTACTTTCTGCCCGTCAACGCCGACTT
TGTTCGCAAGGTCATCCACTACGAGCGCCCGGACGCCATCTACGTCACCTTTGGCGGCCAGACGGCCCTGCAGGT
GGGGATCCAGCTCAAGGACGAGTTCGAGGGCCTCGGTGTCCGCGTCCTGGGCACGCCCATCGACACCATCATCAC
GACCGAGGATCGTGAGCTCTTTGCGCGCAGCATCGAGTCCATTGGCGAAAAGTGCGCCAAGTCGGCCTCGGCCTG
CAACGTCGACGAGGCGCTCGAGGTCGTCAAGGACATCGGCTTCCCCGTCATCGTCCGCGCTGCCTACGCGCTCGG
CGGTCTGGGCAGCGGCTTTGCCAATGACGAGCGCGAGCTGCTCGAGCTGTGTCACAAGGCCTTTGCCGCCAGCCC
TCAGGTGCTCATCGAGCGCAGCATGAAGGGTTGGAAGGAGATTGAGTACGAAGTCGTCCGCGACGCTCAGGACAA
CTGCATCACCGTCTGCAACATGGAGAACTTTGACCCGCTCGGAATCCACACGGGAGACTCCATCGTCGTCGCCCC
CTCGCAGACGCTGTCGGATCAAGACTACAACATGCTGCGGACGACGGCCGTCAACGTCATCCGTCACCTCGGCGT
CGTCGGCGAGTGCAACATCCAGTACGCCCTCAACCCCTTCTCTAGGGAGTACTGCATCATCGAGGTCAACGCGCG
CCTATCGCGGTCGTCGGCGTTGGCCTCCAAGGCGACCGGCTTCCCGTTGGCTTTCATCGCCGCGAAGCTCGGGCT
CGGCATCCCCCTGAAGGAGGTATCCAACTCGGTGACCAAGGTGACGTGCGCGTGCTTCGAGCCCTCGCTCGATTA
CGTCGTCGTCAAGATGCCGCGCTGGGATCTCAACAAGTTCACGCGCGTCTCGACCCAGCTCGGATCGTCGATGAA
GAGCGTGGGCGAGGTCATGAGCATCGGCCGCTCGTTCGAAGAGGCCATTCAGAAGGCGATCCGGGCCATCGACTA
CCACAACCTCGGCTTCGGCCCTACCAAGGCGCTCATGAGTATCGACGACGAGCTGCAGACGCCGTCGGACCAGCG
GCTGTTCGCCATCGCCAACGCCATGCACGAGGGCTACTCGGTCGACAAGATCTGGGACATGACCAAGATCGACAA
GTGGTTCCTGCGCAAGCTCAAGGGCCTCAGCGACTTTGCCAAGGACATGATGGCCATGGCCGGCCGGGGCGCGCG
CGCGCCGCACGTCATGCTCGAGGCCAAGCGGCTCGGCTTCAGCGACCGGCAGCTGGCTCGCTTCTGGGACTCCAA
CGAGATCGCGGTCCGGCGGCAGCGGCAGGAGGCCGGCATCCGTCCGTGGGTCAAGCAGATCGATACCGTCGCGGC
CGAGTTCCCGGCCATGACCAATTACCTGTACATGACGTACAACGCGAGCGAGCACGACGTGCCGTTCGACGACCA
CGGGCTCATGGTGCTGGGCTCGGGCGTGTACCGGATCGGGTCTTCGGTCGAGTTCGACTGGTGCTCGGTACGGGC
GATCCGGACGCTACGCTCATCGGGCTACAAGACGGTCATGGTCAACTTCAACCCGGAGACGGTCAGCACCGACTA
CGACGAGGCGGACCGGCTATACTTTGAGAACATCAACCTGGAGACCGTCCTCGACATCTACCAGCTCGAGGGCGC
GGGCGGCGTGCTGGGCGCCATGGGCGGGCAGACGCCCAACAACATCGCGCTGCCTCTGCACCGGGCCGGCGTGCG
CATGCTGGGCACTTCGCCCGAGATGATCGACATGGCGGAGAACCGGTACAAGTTCTCGCGCATGCTGGACAGGAT
CGAGGTCGATCAGCCGACGTGGCGCGAGCTGACGAGCTTCGACGAGGCCAGCGACTTTTGCAAGGCCGTCGGCTA
CCCGGTCCTCGTCCGGCCGTCGTATGTTCTGTCGGGCGCGGCCATGAACACGGTCTACTCGGAGAAGGACCTGGT
CAACTACCTGGCGCAGGCGGCCGACGTCTCGCGCGAGCATCCCGTCGTCATCTCCAAGTATATCGAGAACGCCAA
GGAGATCGAGATGGACGCCGTGGCTCGCGACGGGCTGGTCGTCGGTCACTTCATCTCGGAGCACGTGGAGAACGC
CGGGGTGCACTCGGGCGACGCGACGCTGATCCTGCCGCCGCAGGACCTGGAGCCGACGACGATTGCGCGCATCGA
GGAGGCGACGCGCAAGATCGGCGCGGCCCTCAACGTGACGGGACCCTTTAACATTCAGTTCATCGCAAAGGACAA
CGACATCAAGGTCATCGAATGCAACGTACGGGCGTCGCGGTCCTTTCCCTTTGTGTCAAAGGTCATGGGCGTCGA
CCTGATCGAGATGGCAACCAAGGCCATCGTCGGCCTGCCCTTTGCCGCCCACCCGCCGACGACGCTGGCGGCCGA
CTGCGTGGCCGTCAAGGTGCCGCAGTTCAGCTTCTCGCGCCTGTCCGGGGCCGATCCGGTGCTGGGCGTCGAGAT
GGCGTCGACGGGCGAGGTGGCCTGCTTCGGAGTCGACAAGTACGAGGCCTACCTCAAGGCGCTGCTCTCGACGGG
CTTCCGCGTGCCCAAGGCCAACGTGCTGCTGTCCATCGGCTCCTACAAGGACAAGCGGGAGATGCTGCCTTGGGT
GCAGAAGCTTCAGCGCATCGGCTACAAGCTGTTCGCCACGGCCGGCACCGCCGACTTCTTGCAGGAGCACGGCGT
GCAGGTGCAGTTCCTCGAGGTGCTGGGGCGCGACGAGGACATGGAGTCGGAGTTCTCCCTGACGCAGCATCTGTC
CAAGAACACCATCGACCTGTACATCAACCTGCCGTCCAACAACAAGTACCGGCGGCCGGCCAACTACATGAGCAA
GGGGTACAAGACGAGGCGCATGGCGGTCGACTACCAGATCCCGCTGGTGACCAACGTCAAGAACGCAAAGATCCT
GGTCGAGGCCATCGCCCGGCACGTGTACCTGGACGTGTCGAAGCGAGACTACCAGTTGACGGGCGAGCAGGAGGA
GGCGGCGGCGGCGGCGGCGGCGGGTGCTTCGACGAGGCCCGGGATGATGCCGACGACGCGGACCGACGACGGCGT
GACGGCGGCGGCGGCATCGATGACGAAGACGACGAAGACGACGGCGGCGGCGGCATCGGCGACGTGCGAAGACGC
CATCAGCGCATCCGTCATGCAGCTCCTCGCCCAGCCGTCGTGCTTCCACAAGGCCAACGTGCTGTCGGTGGAGCA
GTACACGAGGGCCGACCTCCACCTGCTGTTCACGGTGGCACAGGAGATGCGACTCGGGGTGCAGCGCGAGGGCGT
GCTCAACCTGCTACGGGGCAAGGTGCTGTGCACGCTCTTCTACGAGCCGTCGACGCGGACGTCGGCCTCGTTCGA
CGCGGCCATGCAGCGGCTCGGGGGCCGGACGGTGGCGGTGGCGGCGTCGCGGTCGTCGGCGCAAAAGGGCGAGAC
GCTGCGGGACACGCTCCGGACGCTGGCATGCTACGGCGACGCCATCGTGCTCCGACACCCGGACGAGTCGTCGGT
GGACGAGGCGGAGCGGTACGGCGACGTGCCCATCATCAACGCGGGCAACGGCAGCGGCGAGCACCCGACGCAGGC
CTTCCTCGACCTCTTCACCATCCGCGAGGAGCTGGGGACGGTGCAGGGCCTGACGGTGACCTTCGTGGGGGACCT
GCGGCACGGGCGGACGGTGCACTCGCTGGTACGGCTGCTGCGGCACTATCAGGTCAAGGTGCAGCTGGTGGCGCC
GGCCGGGCTGGAGCTCCCGTCGGCGGCGCGGGAGCAGCTGGCGGCATCGGGACAGCTCCTCTGCGAGTCGTCGTC
GCTGACGGCCGAGGTGACGGCCCGGAGCGACGTGCTGTACTGCACGAGGGTGCAGCGGGAGCGGTTCGCTTCGGA
GGAGCAGTACGAGGCGGTGCGCAGCTCGTACCGGGTGGACAACGCGGTGCTCAAGCACGCCAAGGGGTCCATGGT
GGTGATGCATCCGCTTCCGCGCAACGACGAGGTGGCGGACGAGGTCGACTTTGACCAGCGGGCGGCCTATTTCCG
ACAGGTGAGGTGGTTTGTTGGTTGTGCTTTTGTTGGCGTTTGGGCTGAGACTTGACTGACGGTGGGACTCAGATG
CGGTATGGGCTTTACTGCCGGATGGCGCTGTTGGCGCTTGTGATGGCGGGGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail