Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03903
Gene name
Locationscaffold_04:311201..314902
Strand-
Gene length (bp)3701
Transcript length (bp)3591
Coding sequence length (bp)3591
Protein length (aa) 1197

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.9E-72 706 986
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 8.3E-43 25 210
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 4.9E-08 234 338
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.6E-16 585 694
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 2.7E-15 1109 1187

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 108 130 22
3 189 211 22
4 708 730 22
5 762 784 22
6 797 819 22
7 865 887 22
8 919 941 22
9 967 989 22
10 1002 1024 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03903
MLGFLVRREDAASKAQNSQNIGITAFVTAFNTAIIVFFAQVFLFVLLRNRLARIFKPRTYLVPERERTDPPPANL
FVMLRRLLMYDDRQVINKCGLDAYFFLRYLKTLLVIFVPICCVVLPILIPINFIGGRGNQINASSNGTSNGTSNG
TSNGTSNGTSNGTSSLNVTPSGLDTLAWGNVSPKNTNRYGAHLVLAILVVIWVCTVFFFELRVYIKVRQDYLTSA
EHRLRASATTVLVNSIPERWLSVDALAGLFDVFPGGVRNIWLNRDMTKLLDKIEQRGRLHSMLEAAETNMIRAVK
KAQIKQRDAQEKKKRRQQSLKALSKKERAARNAQEDAEASRQANSGEGTNAGCQELTMDSALLSASHDVSDRVSF
ELETVPEEGRKRPGSYAAHGVKKSLSRVGRGFKGAASRASNEVTSSLARSHGFMTSVDQASTTRETWSSKEQGQV
THLHSKSLDTARSHSRSPSDMSNTSHQMTVPASNTVRQLGSIDDMYVQGRTRFWQFWKPPTGAYTSPVPQGETPA
ERTDEKTREDQQRSGWQKFKGSLPLVGTAKKEKEDEQENKAKPEYPPAHEPDVKADDDEDAEWAKYIKAKDRPTH
RLDPFGVHWLPSLPWFNKKVDTIYWCREELARLNLEIEEDQKHPEQFPLMRSAFIQFNHQVAAHMACQSVVHHVP
RQMAPRMNEISPRDVIWANMALRWWQAWLRSGIVCLVVVAMILLWTVPVAWSAVLSQLDKLLRSLGWLGPFENNR
QAMSVLKGLSGVLPTVFLAVALLLVPVLLRLLAGFQGAKTGAQRTEFVQIYFFVFLFVQVFLVVSVASFIGKSVS
DLLVKLSQLSSVSFVLDLLALNLPASANYFFSYMMLQGLSTSAGTLLQVASLFAWFILASLFDSTPRDKWLRNTR
LKEVEWDSLFPVYTNFACIGLVYCVIAPLISIFVIVTFSLLWVAQRYAMLYVCRFETDTGGVLYPRAINQTFTGL
YFMELCMAGLFLIVQDDKNRRTCTTHGIVMIVVLALTVLYQVLLNASFSPLFRYLPITFEDEAVLRDEAFERAQD
ARFGRGREDEGPHRHGMSGGTDASEARGRWRFGEHRRRHRRRDLEAQRAIGDALYGGVPDDIEDLTPDERDVLTR
HAFQHYALRARRPTVWIPRDDVGVSDDEIRRTREYSQHIWISNEGTALDSRVRVVYGRNPPDWSEADIINL*
Coding >Ophcf2|03903
ATGTTGGGCTTCCTGGTGCGTCGCGAAGATGCGGCCTCCAAGGCGCAGAATTCGCAGAACATTGGCATCACGGCC
TTTGTCACCGCCTTCAATACCGCCATCATTGTCTTTTTTGCGCAGGTCTTTCTCTTCGTTCTCCTGCGGAATAGA
CTGGCTCGTATATTTAAACCCAGAACGTATCTGGTCCCTGAACGCGAACGCACCGATCCGCCTCCCGCCAATCTC
TTTGTTATGCTCCGTCGACTCCTCATGTACGACGACCGTCAGGTTATCAACAAGTGCGGTCTCGACGCCTACTTT
TTCCTCCGATACCTCAAGACGCTGCTCGTCATCTTTGTCCCCATCTGCTGCGTCGTTCTGCCTATTCTTATCCCT
ATCAACTTCATCGGCGGAAGGGGGAACCAGATTAACGCCTCGAGCAACGGCACAAGCAACGGCACAAGCAACGGC
ACCAGCAACGGCACCAGCAACGGCACCAGCAACGGCACCTCGTCTCTCAACGTCACGCCCTCGGGCCTTGACACG
CTGGCATGGGGAAACGTCTCACCCAAGAATACCAACCGTTATGGCGCCCACCTGGTGCTGGCCATCTTGGTCGTC
ATCTGGGTTTGCACCGTCTTCTTCTTCGAGCTGCGCGTGTACATCAAGGTCCGTCAGGACTACCTCACCAGCGCC
GAGCATCGCCTACGCGCCTCGGCCACCACCGTTCTCGTCAACTCCATCCCCGAAAGATGGCTGAGCGTCGATGCC
CTCGCCGGACTGTTCGACGTGTTTCCCGGCGGCGTACGCAACATCTGGCTCAACCGGGACATGACCAAACTGCTC
GACAAGATTGAACAGAGGGGCCGCCTTCACTCCATGCTCGAGGCTGCCGAGACCAACATGATCAGGGCCGTCAAG
AAGGCGCAGATCAAGCAGAGAGACGCCCAAGAGAAGAAGAAGCGGAGGCAGCAGAGCCTCAAGGCCCTCTCCAAA
AAGGAGCGCGCCGCCCGGAACGCCCAGGAGGACGCCGAGGCGAGCCGTCAAGCCAACAGCGGCGAGGGCACCAAT
GCCGGCTGCCAGGAGCTGACCATGGACTCCGCCCTCCTCTCTGCCAGCCACGACGTGTCTGACAGGGTCAGCTTC
GAGCTCGAGACGGTGCCGGAAGAGGGCCGGAAGCGGCCCGGCAGCTACGCCGCCCACGGCGTCAAGAAGTCTCTG
TCCAGGGTCGGCAGGGGTTTCAAGGGTGCGGCCAGCAGGGCCAGTAACGAAGTGACCAGCTCGTTGGCTCGGAGC
CACGGCTTCATGACGTCGGTCGACCAGGCGTCGACGACTCGCGAGACTTGGAGTTCGAAGGAGCAGGGACAGGTG
ACGCATCTGCACTCGAAATCGCTCGACACGGCCCGATCCCACTCCCGAAGCCCGTCGGACATGTCGAACACGTCT
CACCAGATGACGGTCCCCGCCAGCAACACGGTACGTCAGCTCGGCAGCATAGACGACATGTACGTCCAGGGGCGC
ACCAGGTTCTGGCAGTTTTGGAAGCCTCCGACGGGTGCCTACACGTCTCCCGTGCCACAAGGGGAGACGCCGGCC
GAGAGGACGGACGAGAAGACGCGGGAGGACCAGCAGAGGTCTGGCTGGCAAAAGTTCAAGGGGTCGCTGCCGTTG
GTGGGCACTGCCAAGAAGGAGAAGGAGGATGAGCAGGAGAACAAGGCAAAGCCGGAGTATCCCCCGGCTCACGAG
CCCGACGTCAAGGCGGACGACGACGAGGACGCCGAATGGGCCAAATACATCAAGGCCAAGGACAGGCCCACGCAC
CGGCTGGACCCCTTTGGCGTGCACTGGCTGCCGAGCCTCCCCTGGTTCAACAAAAAGGTCGACACCATCTACTGG
TGCCGAGAGGAGCTGGCGCGGCTCAACCTGGAGATTGAGGAGGACCAGAAGCATCCGGAGCAGTTCCCGCTGATG
AGGTCGGCCTTTATCCAGTTCAACCACCAGGTGGCGGCTCACATGGCCTGCCAGAGCGTGGTCCATCACGTCCCG
CGACAGATGGCGCCGCGCATGAACGAGATCTCTCCGCGAGACGTCATCTGGGCCAACATGGCGCTGAGATGGTGG
CAGGCCTGGCTGCGGTCCGGCATCGTCTGCCTCGTCGTCGTGGCCATGATCCTGCTCTGGACCGTCCCAGTGGCC
TGGTCGGCGGTGCTGAGCCAGTTGGACAAGCTGCTGCGGTCGCTCGGATGGCTGGGTCCGTTCGAGAACAACCGG
CAGGCCATGAGCGTCCTCAAGGGCCTCTCTGGCGTGTTGCCGACCGTCTTCCTGGCCGTGGCGCTGCTGCTGGTG
CCCGTGCTTCTCAGGCTTCTGGCGGGCTTCCAGGGGGCCAAGACGGGGGCGCAGCGGACCGAGTTCGTGCAGATC
TACTTCTTCGTCTTCCTGTTCGTTCAGGTGTTCCTGGTCGTCTCCGTCGCGTCCTTCATCGGCAAGTCGGTGTCG
GACTTGCTGGTCAAGCTGTCGCAACTATCGTCGGTCTCTTTCGTGCTGGACCTGCTGGCGCTCAACCTGCCGGCC
TCGGCCAACTACTTCTTCTCCTACATGATGCTGCAGGGCCTGTCGACGAGCGCGGGCACCCTCCTGCAGGTGGCC
TCCCTGTTCGCCTGGTTCATCCTCGCCTCTCTCTTCGACAGCACGCCGCGCGACAAGTGGCTGCGCAACACGCGC
CTGAAGGAGGTGGAGTGGGACAGCCTGTTCCCCGTCTATACCAACTTCGCCTGCATCGGGCTCGTCTACTGCGTC
ATCGCGCCCCTGATCAGCATCTTCGTCATCGTCACCTTTAGCCTGCTGTGGGTGGCGCAGCGGTACGCGATGCTG
TACGTGTGCCGGTTCGAGACGGACACGGGGGGCGTGCTGTACCCGCGGGCCATCAACCAGACCTTCACGGGCCTC
TACTTCATGGAGCTGTGCATGGCCGGCTTGTTCCTCATAGTGCAGGACGACAAGAACAGGCGGACTTGCACGACT
CACGGCATCGTCATGATCGTCGTCCTGGCGCTGACGGTGCTGTATCAGGTGCTGCTCAACGCTTCCTTCTCGCCT
CTGTTCCGCTACCTGCCCATCACGTTCGAGGACGAGGCGGTGCTGCGGGACGAGGCCTTTGAGCGCGCGCAGGAC
GCCCGGTTCGGTAGAGGGCGCGAGGACGAGGGACCTCATCGGCACGGCATGTCCGGGGGGACCGACGCGTCCGAG
GCCAGGGGACGGTGGCGCTTCGGCGAGCACCGGAGACGACACCGGCGTCGGGACCTCGAGGCCCAGCGCGCCATA
GGGGACGCCCTGTACGGGGGGGTCCCGGACGACATAGAGGACCTCACGCCGGACGAGAGGGACGTGTTGACGAGG
CACGCGTTCCAGCACTACGCGCTGAGGGCGCGGAGGCCGACGGTCTGGATCCCGCGGGACGACGTCGGCGTCAGC
GACGACGAGATCCGCCGGACGCGAGAGTACAGCCAGCACATCTGGATCAGCAACGAGGGGACCGCTCTGGATAGC
AGGGTGAGGGTCGTCTACGGCCGGAACCCGCCTGACTGGTCCGAGGCGGACATTATCAACCTGTGA
Transcript >Ophcf2|03903
ATGTTGGGCTTCCTGGTGCGTCGCGAAGATGCGGCCTCCAAGGCGCAGAATTCGCAGAACATTGGCATCACGGCC
TTTGTCACCGCCTTCAATACCGCCATCATTGTCTTTTTTGCGCAGGTCTTTCTCTTCGTTCTCCTGCGGAATAGA
CTGGCTCGTATATTTAAACCCAGAACGTATCTGGTCCCTGAACGCGAACGCACCGATCCGCCTCCCGCCAATCTC
TTTGTTATGCTCCGTCGACTCCTCATGTACGACGACCGTCAGGTTATCAACAAGTGCGGTCTCGACGCCTACTTT
TTCCTCCGATACCTCAAGACGCTGCTCGTCATCTTTGTCCCCATCTGCTGCGTCGTTCTGCCTATTCTTATCCCT
ATCAACTTCATCGGCGGAAGGGGGAACCAGATTAACGCCTCGAGCAACGGCACAAGCAACGGCACAAGCAACGGC
ACCAGCAACGGCACCAGCAACGGCACCAGCAACGGCACCTCGTCTCTCAACGTCACGCCCTCGGGCCTTGACACG
CTGGCATGGGGAAACGTCTCACCCAAGAATACCAACCGTTATGGCGCCCACCTGGTGCTGGCCATCTTGGTCGTC
ATCTGGGTTTGCACCGTCTTCTTCTTCGAGCTGCGCGTGTACATCAAGGTCCGTCAGGACTACCTCACCAGCGCC
GAGCATCGCCTACGCGCCTCGGCCACCACCGTTCTCGTCAACTCCATCCCCGAAAGATGGCTGAGCGTCGATGCC
CTCGCCGGACTGTTCGACGTGTTTCCCGGCGGCGTACGCAACATCTGGCTCAACCGGGACATGACCAAACTGCTC
GACAAGATTGAACAGAGGGGCCGCCTTCACTCCATGCTCGAGGCTGCCGAGACCAACATGATCAGGGCCGTCAAG
AAGGCGCAGATCAAGCAGAGAGACGCCCAAGAGAAGAAGAAGCGGAGGCAGCAGAGCCTCAAGGCCCTCTCCAAA
AAGGAGCGCGCCGCCCGGAACGCCCAGGAGGACGCCGAGGCGAGCCGTCAAGCCAACAGCGGCGAGGGCACCAAT
GCCGGCTGCCAGGAGCTGACCATGGACTCCGCCCTCCTCTCTGCCAGCCACGACGTGTCTGACAGGGTCAGCTTC
GAGCTCGAGACGGTGCCGGAAGAGGGCCGGAAGCGGCCCGGCAGCTACGCCGCCCACGGCGTCAAGAAGTCTCTG
TCCAGGGTCGGCAGGGGTTTCAAGGGTGCGGCCAGCAGGGCCAGTAACGAAGTGACCAGCTCGTTGGCTCGGAGC
CACGGCTTCATGACGTCGGTCGACCAGGCGTCGACGACTCGCGAGACTTGGAGTTCGAAGGAGCAGGGACAGGTG
ACGCATCTGCACTCGAAATCGCTCGACACGGCCCGATCCCACTCCCGAAGCCCGTCGGACATGTCGAACACGTCT
CACCAGATGACGGTCCCCGCCAGCAACACGGTACGTCAGCTCGGCAGCATAGACGACATGTACGTCCAGGGGCGC
ACCAGGTTCTGGCAGTTTTGGAAGCCTCCGACGGGTGCCTACACGTCTCCCGTGCCACAAGGGGAGACGCCGGCC
GAGAGGACGGACGAGAAGACGCGGGAGGACCAGCAGAGGTCTGGCTGGCAAAAGTTCAAGGGGTCGCTGCCGTTG
GTGGGCACTGCCAAGAAGGAGAAGGAGGATGAGCAGGAGAACAAGGCAAAGCCGGAGTATCCCCCGGCTCACGAG
CCCGACGTCAAGGCGGACGACGACGAGGACGCCGAATGGGCCAAATACATCAAGGCCAAGGACAGGCCCACGCAC
CGGCTGGACCCCTTTGGCGTGCACTGGCTGCCGAGCCTCCCCTGGTTCAACAAAAAGGTCGACACCATCTACTGG
TGCCGAGAGGAGCTGGCGCGGCTCAACCTGGAGATTGAGGAGGACCAGAAGCATCCGGAGCAGTTCCCGCTGATG
AGGTCGGCCTTTATCCAGTTCAACCACCAGGTGGCGGCTCACATGGCCTGCCAGAGCGTGGTCCATCACGTCCCG
CGACAGATGGCGCCGCGCATGAACGAGATCTCTCCGCGAGACGTCATCTGGGCCAACATGGCGCTGAGATGGTGG
CAGGCCTGGCTGCGGTCCGGCATCGTCTGCCTCGTCGTCGTGGCCATGATCCTGCTCTGGACCGTCCCAGTGGCC
TGGTCGGCGGTGCTGAGCCAGTTGGACAAGCTGCTGCGGTCGCTCGGATGGCTGGGTCCGTTCGAGAACAACCGG
CAGGCCATGAGCGTCCTCAAGGGCCTCTCTGGCGTGTTGCCGACCGTCTTCCTGGCCGTGGCGCTGCTGCTGGTG
CCCGTGCTTCTCAGGCTTCTGGCGGGCTTCCAGGGGGCCAAGACGGGGGCGCAGCGGACCGAGTTCGTGCAGATC
TACTTCTTCGTCTTCCTGTTCGTTCAGGTGTTCCTGGTCGTCTCCGTCGCGTCCTTCATCGGCAAGTCGGTGTCG
GACTTGCTGGTCAAGCTGTCGCAACTATCGTCGGTCTCTTTCGTGCTGGACCTGCTGGCGCTCAACCTGCCGGCC
TCGGCCAACTACTTCTTCTCCTACATGATGCTGCAGGGCCTGTCGACGAGCGCGGGCACCCTCCTGCAGGTGGCC
TCCCTGTTCGCCTGGTTCATCCTCGCCTCTCTCTTCGACAGCACGCCGCGCGACAAGTGGCTGCGCAACACGCGC
CTGAAGGAGGTGGAGTGGGACAGCCTGTTCCCCGTCTATACCAACTTCGCCTGCATCGGGCTCGTCTACTGCGTC
ATCGCGCCCCTGATCAGCATCTTCGTCATCGTCACCTTTAGCCTGCTGTGGGTGGCGCAGCGGTACGCGATGCTG
TACGTGTGCCGGTTCGAGACGGACACGGGGGGCGTGCTGTACCCGCGGGCCATCAACCAGACCTTCACGGGCCTC
TACTTCATGGAGCTGTGCATGGCCGGCTTGTTCCTCATAGTGCAGGACGACAAGAACAGGCGGACTTGCACGACT
CACGGCATCGTCATGATCGTCGTCCTGGCGCTGACGGTGCTGTATCAGGTGCTGCTCAACGCTTCCTTCTCGCCT
CTGTTCCGCTACCTGCCCATCACGTTCGAGGACGAGGCGGTGCTGCGGGACGAGGCCTTTGAGCGCGCGCAGGAC
GCCCGGTTCGGTAGAGGGCGCGAGGACGAGGGACCTCATCGGCACGGCATGTCCGGGGGGACCGACGCGTCCGAG
GCCAGGGGACGGTGGCGCTTCGGCGAGCACCGGAGACGACACCGGCGTCGGGACCTCGAGGCCCAGCGCGCCATA
GGGGACGCCCTGTACGGGGGGGTCCCGGACGACATAGAGGACCTCACGCCGGACGAGAGGGACGTGTTGACGAGG
CACGCGTTCCAGCACTACGCGCTGAGGGCGCGGAGGCCGACGGTCTGGATCCCGCGGGACGACGTCGGCGTCAGC
GACGACGAGATCCGCCGGACGCGAGAGTACAGCCAGCACATCTGGATCAGCAACGAGGGGACCGCTCTGGATAGC
AGGGTGAGGGTCGTCTACGGCCGGAACCCGCCTGACTGGTCCGAGGCGGACATTATCAACCTGTGA
Gene >Ophcf2|03903
ATGTTGGGCTTCCTGGTGCGTCGCGAAGATGCGGCCTCCAAGGCGCAGAATTCGCAGAACATTGGCATCACGGCC
TTTGTCACCGCCTTCAATACCGCCATCATTGTCTTTTTTGCGCAGGTCTTTCTCTTCGTTCTCCTGCGGAATAGA
CTGGCTCGTATATTGTACGTTGCCGGCGTTGTTGCTGCTGCCACTGCCACTGCCACTGCTACTGCTACTGCTGCT
GCTACCACTCCTCTACCCGTCCGTTTCGAACGCTCACCTCGCTCTGCAGTAAACCCAGAACGTATCTGGTCCCTG
AACGCGAACGCACCGATCCGCCTCCCGCCAATCTCTTTGTTATGCTCCGTCGACTCCTCATGTACGACGACCGTC
AGGTTATCAACAAGTGCGGTCTCGACGCCTACTTTTTCCTCCGATACCTCAAGACGCTGCTCGTCATCTTTGTCC
CCATCTGCTGCGTCGTTCTGCCTATTCTTATCCCTATCAACTTCATCGGCGGAAGGGGGAACCAGATTAACGCCT
CGAGCAACGGCACAAGCAACGGCACAAGCAACGGCACCAGCAACGGCACCAGCAACGGCACCAGCAACGGCACCT
CGTCTCTCAACGTCACGCCCTCGGGCCTTGACACGCTGGCATGGGGAAACGTCTCACCCAAGAATACCAACCGTT
ATGGCGCCCACCTGGTGCTGGCCATCTTGGTCGTCATCTGGGTTTGCACCGTCTTCTTCTTCGAGCTGCGCGTGT
ACATCAAGGTCCGTCAGGACTACCTCACCAGCGCCGAGCATCGCCTACGCGCCTCGGCCACCACCGTTCTCGTCA
ACTCCATCCCCGAAAGATGGCTGAGCGTCGATGCCCTCGCCGGACTGTTCGACGTGTTTCCCGGCGGCGTACGCA
ACATCTGGCTCAACCGGGACATGACCAAACTGCTCGACAAGATTGAACAGAGGGGCCGCCTTCACTCCATGCTCG
AGGCTGCCGAGACCAACATGATCAGGGCCGTCAAGAAGGCGCAGATCAAGCAGAGAGACGCCCAAGAGAAGAAGA
AGCGGAGGCAGCAGAGCCTCAAGGCCCTCTCCAAAAAGGAGCGCGCCGCCCGGAACGCCCAGGAGGACGCCGAGG
CGAGCCGTCAAGCCAACAGCGGCGAGGGCACCAATGCCGGCTGCCAGGAGCTGACCATGGACTCCGCCCTCCTCT
CTGCCAGCCACGACGTGTCTGACAGGGTCAGCTTCGAGCTCGAGACGGTGCCGGAAGAGGGCCGGAAGCGGCCCG
GCAGCTACGCCGCCCACGGCGTCAAGAAGTCTCTGTCCAGGGTCGGCAGGGGTTTCAAGGGTGCGGCCAGCAGGG
CCAGTAACGAAGTGACCAGCTCGTTGGCTCGGAGCCACGGCTTCATGACGTCGGTCGACCAGGCGTCGACGACTC
GCGAGACTTGGAGTTCGAAGGAGCAGGGACAGGTGACGCATCTGCACTCGAAATCGCTCGACACGGCCCGATCCC
ACTCCCGAAGCCCGTCGGACATGTCGAACACGTCTCACCAGATGACGGTCCCCGCCAGCAACACGGTACGTCAGC
TCGGCAGCATAGACGACATGTACGTCCAGGGGCGCACCAGGTTCTGGCAGTTTTGGAAGCCTCCGACGGGTGCCT
ACACGTCTCCCGTGCCACAAGGGGAGACGCCGGCCGAGAGGACGGACGAGAAGACGCGGGAGGACCAGCAGAGGT
CTGGCTGGCAAAAGTTCAAGGGGTCGCTGCCGTTGGTGGGCACTGCCAAGAAGGAGAAGGAGGATGAGCAGGAGA
ACAAGGCAAAGCCGGAGTATCCCCCGGCTCACGAGCCCGACGTCAAGGCGGACGACGACGAGGACGCCGAATGGG
CCAAATACATCAAGGCCAAGGACAGGCCCACGCACCGGCTGGACCCCTTTGGCGTGCACTGGCTGCCGAGCCTCC
CCTGGTTCAACAAAAAGGTCGACACCATCTACTGGTGCCGAGAGGAGCTGGCGCGGCTCAACCTGGAGATTGAGG
AGGACCAGAAGCATCCGGAGCAGTTCCCGCTGATGAGGTCGGCCTTTATCCAGTTCAACCACCAGGTGGCGGCTC
ACATGGCCTGCCAGAGCGTGGTCCATCACGTCCCGCGACAGATGGCGCCGCGCATGAACGAGATCTCTCCGCGAG
ACGTCATCTGGGCCAACATGGCGCTGAGATGGTGGCAGGCCTGGCTGCGGTCCGGCATCGTCTGCCTCGTCGTCG
TGGCCATGATCCTGCTCTGGACCGTCCCAGTGGCCTGGTCGGCGGTGCTGAGCCAGTTGGACAAGCTGCTGCGGT
CGCTCGGATGGCTGGGTCCGTTCGAGAACAACCGGCAGGCCATGAGCGTCCTCAAGGGCCTCTCTGGCGTGTTGC
CGACCGTCTTCCTGGCCGTGGCGCTGCTGCTGGTGCCCGTGCTTCTCAGGCTTCTGGCGGGCTTCCAGGGGGCCA
AGACGGGGGCGCAGCGGACCGAGTTCGTGCAGATCTACTTCTTCGTCTTCCTGTTCGTTCAGGTGTTCCTGGTCG
TCTCCGTCGCGTCCTTCATCGGCAAGTCGGTGTCGGACTTGCTGGTCAAGCTGTCGCAACTATCGTCGGTCTCTT
TCGTGCTGGACCTGCTGGCGCTCAACCTGCCGGCCTCGGCCAACTACTTCTTCTCCTACATGATGCTGCAGGGCC
TGTCGACGAGCGCGGGCACCCTCCTGCAGGTGGCCTCCCTGTTCGCCTGGTTCATCCTCGCCTCTCTCTTCGACA
GCACGCCGCGCGACAAGTGGCTGCGCAACACGCGCCTGAAGGAGGTGGAGTGGGACAGCCTGTTCCCCGTCTATA
CCAACTTCGCCTGCATCGGGCTCGTCTACTGCGTCATCGCGCCCCTGATCAGCATCTTCGTCATCGTCACCTTTA
GCCTGCTGTGGGTGGCGCAGCGGTACGCGATGCTGTACGTGTGCCGGTTCGAGACGGACACGGGGGGCGTGCTGT
ACCCGCGGGCCATCAACCAGACCTTCACGGGCCTCTACTTCATGGAGCTGTGCATGGCCGGCTTGTTCCTCATAG
TGCAGGACGACAAGAACAGGCGGACTTGCACGACTCACGGCATCGTCATGATCGTCGTCCTGGCGCTGACGGTGC
TGTATCAGGTGCTGCTCAACGCTTCCTTCTCGCCTCTGTTCCGCTACCTGCCCATCACGTTCGAGGACGAGGCGG
TGCTGCGGGACGAGGCCTTTGAGCGCGCGCAGGACGCCCGGTTCGGTAGAGGGCGCGAGGACGAGGGACCTCATC
GGCACGGCATGTCCGGGGGGACCGACGCGTCCGAGGCCAGGGGACGGTGGCGCTTCGGCGAGCACCGGAGACGAC
ACCGGCGTCGGGACCTCGAGGCCCAGCGCGCCATAGGGGACGCCCTGTACGGGGGGGTCCCGGACGACATAGAGG
ACCTCACGCCGGACGAGAGGGACGTGTTGACGAGGCACGCGTTCCAGCACTACGCGCTGAGGGCGCGGAGGCCGA
CGGTCTGGATCCCGCGGGACGACGTCGGCGTCAGCGACGACGAGATCCGCCGGACGCGAGAGTACAGCCAGCACA
TCTGGATCAGCAACGAGGGGACCGCTCTGGATAGCAGGGTGAGGGTCGTCTACGGCCGGAACCCGCCTGACTGGT
CCGAGGCGGACATTATCAACCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail