Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03894
Gene name
Locationscaffold_04:270798..271963
Strand-
Gene length (bp)1165
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.4462 0.3474 0.3278 0.2706 0.4324 0.062 0.5477 0.255 0.2965 0.1

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.56195

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3712
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7841
Ophiocordyceps australis map64 (Brazil) OphauB2|6467
Ophiocordyceps camponoti-floridani Ophcf2|03894 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4836
Ophiocordyceps kimflemingae Ophio5|7203
Ophiocordyceps subramaniannii Hirsu2|7230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03894
MILELISFILIILILAMPNLHVPDLPDFLRGANETSPAADSSPETSPTPDDIVLLRAALHRAKGLPPDIVDCIFD
FAEFWARSSSVVNYGSEMRQSKSIVASCPQENTFLLRSPPLGLTHVCRGNIRLAEELVYDSSEARPIPLTREHDA
AYFSRLVDYPTPRLVNPCRKIVFSIRSHDQGWGNHDGSYASSWTWFEAGLERFDAAQECDEKCTYDARRDSSTET
PPALPVCGIRPVQPTISVLTDQDETRYLYDHPLLPDDRYNICRNKAACRDWQDHVVAWSYLDDVEPTSDAGADLH
QKGRGRASADGSFVRGLRLGDVVTVWGKARFPQWINTVDSVRIDVYWAV*
Coding >Ophcf2|03894
ATGATCCTTGAACTCATCAGCTTCATCCTCATCATCCTCATCCTCGCCATGCCTAACCTCCACGTCCCAGACCTT
CCCGACTTCCTGCGGGGCGCCAACGAAACCTCCCCAGCAGCAGACTCCTCCCCGGAAACGAGCCCTACGCCCGAC
GACATCGTCCTGTTGCGAGCGGCGCTGCATCGCGCAAAGGGCCTGCCGCCTGATATCGTCGACTGCATCTTTGAC
TTTGCCGAGTTTTGGGCGCGGTCGTCTTCTGTTGTCAACTATGGCTCTGAGATGCGGCAGAGTAAGAGCATCGTT
GCTTCGTGTCCGCAGGAGAACACCTTTCTCCTTCGATCTCCGCCTCTTGGTCTGACGCATGTCTGTCGCGGGAAT
ATCCGTCTGGCTGAGGAACTGGTGTATGACTCGAGCGAGGCACGGCCCATTCCCTTGACGCGGGAACATGACGCT
GCGTATTTCTCCCGTTTGGTCGATTATCCGACGCCGAGACTAGTCAACCCATGTCGAAAGATTGTCTTTTCCATC
AGGAGTCATGATCAAGGCTGGGGCAACCACGATGGTTCTTATGCGAGTTCCTGGACCTGGTTCGAAGCTGGTCTC
GAGCGCTTCGATGCTGCTCAAGAGTGCGATGAAAAGTGCACCTATGACGCCCGCCGCGATTCGTCGACGGAAACT
CCTCCGGCCCTCCCCGTCTGCGGCATCCGCCCCGTCCAGCCAACAATAAGTGTTCTGACCGACCAAGACGAGACG
CGCTATCTGTATGATCACCCCCTTCTTCCCGATGATCGATACAACATCTGTCGCAACAAAGCTGCCTGTCGCGAC
TGGCAAGACCACGTCGTCGCCTGGTCCTACCTAGACGACGTCGAGCCCACCTCTGACGCCGGCGCCGATCTCCAT
CAGAAGGGTCGCGGCCGCGCCTCTGCAGACGGCTCCTTTGTTCGTGGTCTCAGGCTTGGCGACGTCGTCACCGTC
TGGGGAAAGGCCCGCTTCCCGCAGTGGATCAACACGGTCGACTCGGTTCGCATCGACGTTTACTGGGCTGTGTGA
Transcript >Ophcf2|03894
ATGATCCTTGAACTCATCAGCTTCATCCTCATCATCCTCATCCTCGCCATGCCTAACCTCCACGTCCCAGACCTT
CCCGACTTCCTGCGGGGCGCCAACGAAACCTCCCCAGCAGCAGACTCCTCCCCGGAAACGAGCCCTACGCCCGAC
GACATCGTCCTGTTGCGAGCGGCGCTGCATCGCGCAAAGGGCCTGCCGCCTGATATCGTCGACTGCATCTTTGAC
TTTGCCGAGTTTTGGGCGCGGTCGTCTTCTGTTGTCAACTATGGCTCTGAGATGCGGCAGAGTAAGAGCATCGTT
GCTTCGTGTCCGCAGGAGAACACCTTTCTCCTTCGATCTCCGCCTCTTGGTCTGACGCATGTCTGTCGCGGGAAT
ATCCGTCTGGCTGAGGAACTGGTGTATGACTCGAGCGAGGCACGGCCCATTCCCTTGACGCGGGAACATGACGCT
GCGTATTTCTCCCGTTTGGTCGATTATCCGACGCCGAGACTAGTCAACCCATGTCGAAAGATTGTCTTTTCCATC
AGGAGTCATGATCAAGGCTGGGGCAACCACGATGGTTCTTATGCGAGTTCCTGGACCTGGTTCGAAGCTGGTCTC
GAGCGCTTCGATGCTGCTCAAGAGTGCGATGAAAAGTGCACCTATGACGCCCGCCGCGATTCGTCGACGGAAACT
CCTCCGGCCCTCCCCGTCTGCGGCATCCGCCCCGTCCAGCCAACAATAAGTGTTCTGACCGACCAAGACGAGACG
CGCTATCTGTATGATCACCCCCTTCTTCCCGATGATCGATACAACATCTGTCGCAACAAAGCTGCCTGTCGCGAC
TGGCAAGACCACGTCGTCGCCTGGTCCTACCTAGACGACGTCGAGCCCACCTCTGACGCCGGCGCCGATCTCCAT
CAGAAGGGTCGCGGCCGCGCCTCTGCAGACGGCTCCTTTGTTCGTGGTCTCAGGCTTGGCGACGTCGTCACCGTC
TGGGGAAAGGCCCGCTTCCCGCAGTGGATCAACACGGTCGACTCGGTTCGCATCGACGTTTACTGGGCTGTGTGA
Gene >Ophcf2|03894
ATGATCCTTGAACTCATCAGCTTCATCCTCATCATCCTCATCCTCGCCATGCCTAACCTCCACGTCCCAGACCTT
CCCGACTTCCTGCGGGGCGCCAACGAAACCTCCCCAGCAGCAGACTCCTCCCCGGAAACGAGCCCTACGCCCGAC
GACATCGTCCTGTTGCGAGCGGCGCTGCATCGCGCAAAGGGCCTGCCGCCTGATATCGTCGACTGCATCTTTGAC
TTTGCCGAGTTTTGGGCGCGGTCGTCTTCTGTTGTCAACTATGGCTCTGAGATGCGGCAGAGTAAGAGCATCGTT
GCTTCGTGTCCGCAGGAGAACACCTTTCTCGTATGTGAGGCCTCCAACGTCGTCTTCCTTGTTCGTCTCTGATTT
GGTGCTTCTTTCAGCTTCGATCTCCGCCTCTTGGTCTGACGCATGTCTGTCGCGGGAATATCCGTCTGGCTGAGG
AACTGGTGTATGACTCGAGCGAGGCACGGCCCATTCCCTTGACGCGGGAACATGACGCTGCGTATTTCTCCCGTT
TGGTCGATTATCCGACGCCGAGACTAGTCAACCCATGTCGAAAGATTGTCTTTTCCATCAGGAGTCATGATCAAG
GCTGGGGCAACCACGATGGTTCTTATGCGAGTTCCTGGACCTGGTTCGAAGCTGGTCTCGAGCGCTTCGATGCTG
CTCAAGAGTGCAAGTCTCCCCTCGTTTGAGCCTTGGATCCATACATACTGACTTTGTGTCCTCAGGCGATGAAAA
GTGCACCTATGACGCCCGCCGCGATTCGTCGACGGAAACTCCTCCGGCCCTCCCCGTCTGCGGCATCCGCCCCGT
CCAGCCAACAATAAGTGTTCTGACCGACCAAGACGAGACGCGCTATCTGTATGATCACCCCCTTCTTCCCGATGA
TCGATACAACATCTGTCGCAACAAAGCTGCCTGTCGCGACTGGCAAGACCACGTCGTCGCCTGGTCCTACCTAGA
CGACGTCGAGCCCACCTCTGACGCCGGCGCCGATCTCCATCAGAAGGGTCGCGGCCGCGCCTCTGCAGACGGCTC
CTTTGTTCGTGGTCTCAGGCTTGGCGACGTCGTCACCGTCTGGGGAAAGGCCCGCTTCCCGCAGTGGATCAACAC
GGTCGACTCGGTTCGCATCGACGTTTACTGGGCTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail