Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03886
Gene name
Locationscaffold_04:243239..251350
Strand+
Gene length (bp)8111
Transcript length (bp)7731
Coding sequence length (bp)7731
Protein length (aa) 2577

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02138 Beach Beige/BEACH domain 6.2E-114 1987 2265
PF14844 PH_BEACH PH domain associated with Beige/BEACH 1.0E-08 1870 1931
PF13385 Laminin_G_3 Concanavalin A-like lectin/glucanases superfamily 8.6E-08 367 482

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole Nuclear export signal 0.5457 0.45 0.0682 0.1217 0.1541 0.0349 0.25 0.5719 0.5211 0.0122

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2741
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6327
Ophiocordyceps australis map64 (Brazil) OphauB2|3408
Ophiocordyceps camponoti-floridani Ophcf2|03886 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3864
Ophiocordyceps kimflemingae Ophio5|1620
Ophiocordyceps subramaniannii Hirsu2|4329

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03886
MAFSLRRRRGSTLHSQQPTSDSYNVLCGLLDSLSDEAASLGADGYPRVDSLVKDLKLVTRHVTQSPSSSACADGF
RHAHGFESVLAVLRCFSGYYDPHKRDECDMLSLFDLLGASLDLLSVVLRDRPANKRFFCHGVEGGGWEALEQVIA
SIGLGGAELDPWVSCNVFGKLLSFSLDDDSLDLLCQSVAKALRPEAAVSASHSQDDEQWELVLSRSIENVGPAVR
EVVTSGTIVRFPEILRAVVSFWTAIPRPHGSSASPSSVLVLETLLRVVSVSFYNRAAVHSTGVLSQLLRVTFGQD
IWLAEPERERLPAICRLLMALGVNEPADTQFLLSAQGTAASEFCLEIMSEHTGPPFFQFDLSLCGYSALELPSLG
RSFPPQSSAGYTFAAWVRVETFDPSAHTTMFGLYDSSQTCFLLLYLERDTRNVILQTSIHSSKPSVRFKSVVFHE
HKWYHIAVVHRRPKTMTASKALLYVNGDFAEQVRCSYPRSPPIMNGSVESFTSLNPSQSRSSSVQAFLGTPRDLA
GRTGPGVVQSRWSLASAHLFEDTMSDDYLAVHYGLGPRYQGNFQDSLGGFQTYEASAALGLRNELVHPGKDENSD
ILRAVRDKASSLLPESRILLSALPVGTFPEHVQFLDTGVLRSLPRISVRNLVQMSNKEGTPLAVNCAVSSLSDAL
MRTSGVASLSGSPIVALPSHLDENLWRLAGFTPLALKLLERASTTEELIRAVEIMFHSIRRSWRNSEAMERDNGY
CILGMILRFKIGYASGEGPISRLSISNEERDSLTFRLLSLILGFVGYKHVEPIESFIVNPLAYRILLIDLDIWRR
AAHRTQELFYKQFVTFAVNSKHHEFNNRRLIRMRVVKRLLDSTKGEGVSEQIVHHFMSAFEALVKSNLSQEVMRY
LSLFITYAFHTSPPSASRTPKAPSASQLSISGLARQLTGDVPRARSPSAPDTRVLSKKQLGIRVLALYAGILCEK
NNFNNIKRFARTVTNKWLLYLLADDDASVVLHGSMILSRLLVAHGSSYTSKFTGKSGGFIVMAARLKRFWDIPTV
WAICFSIMFGYDIAELDLDRPFDVDNLLDIFGRRKVVYPEFLAVIRSLLQHGVKEVMRHQEDPDSPAKVDGSLAA
MRAKPKSETGLRVMSMNPTKAIEARTSLSDPYDGVSGRAAVLQTSIRFLQELHARSSSFRDFCLSSEWVRTLLLV
LYPAMVGTDAVTPEVELNSRDSVLTFEGSDVIIRPISGVQTAAPIVRTSRVDVVPSPQATPPRATPLRRASSFVL
LTAQKAPRVEDRLPALSPQLQARQSSGGIVSEGILDLLVAIFMDQIFTRRDFVGLGLSSNVPPGFQEHQAYLESQ
ILKRVMCRVSDHIHANKKTICEPRVLTNLSRLCSQMSEAIFEGWFMDGAEVMIDFNGMLLEQLQRPDIGRMKSVR
LCSQAVAVIRGCFLRIILLKLSDLDNARITEREAKDFMNMLAYWQMSILECFTLEDEYMRLFWYQLYTKLIDDRR
SIRIAAANFLRIVLVQKPEQSVAMVRSGSGPDQKKLCREFQKLTEVDDDTFVAWVDQHRPSLDGLFLGNMAKTWE
DFVGLEYQKSLEGARNRASRRKERLRAWNVEALSTDKVLVNHEVGNSAWMKSIYNTEHFKYQRLLQDQQDDLSFL
MAGYSKMERDLRRPGAVFSEPAPVKWKLDRTEGRNRMRLRLLPDSPATEEKYRPKRKVAEARASGPGVTAVNTEA
KTAVKTAVGFPAPNGDPEPSLELDGNDESSSLNAEAASTAESACATDDDFELVQDPNEGDENFEDKNRKVMRRLE
PGEQVQAAYNMSRITGLEACEGLLIVGKDALYIMDNVFQCASGEIVDVWQAPADERDPFSMVVTGAKTLERRQNS
GARDQESRHWRWHDVISVSKRRFLFRDVAIEVFFTDGRSYLLTTIKAAVRDELFAKMVTKAGAKAVLNGEEGWRL
ETLKTADNELPQSFGAGLGSKLGTLFNAVPWNPAMRRWQRGELSNFHYLMMVNTMAGRTFNDLTQYPVFPWILAD
YSSEELDLDDPATFRDLSKPMGGQTQGRVAGFVETYKALQEIGQTPFHYGTHYSSAMIVSSYLIRLPPFVQSYLL
VQGDSFDHADRLFQSVGDAWESASRRNKTDVRELIPEFFCLPDFLTNINGYDFGHRQSNGVKVDNVALPPWAKGD
ARIFIAKHREALESRYVSENLHHWIDLVFGCKQRGEAAVESINVFHHLSYAGASDLDRITDANERAITAGVIHNF
GQTPHQVFSKPHPARDHFRCPIRRLDTAVSSLSRPDHPMLESHERVASLVYVTKSDRLLCASPLRLNFPPYDKFL
EWGYADGSIRFFFSDNRKPAGLFENLHIGQISCACFADSKTLITAGEDCVVSVYSVVTSLGKQVELVPRSSVFGH
KTPVTAMAVSRALSTFVTASSDGQAFLWDLNRLSFIRKLPLVRQVECARINDVSGDVMLCSGPYVVLYTLNGSLL
LEQKVCEGEDYLHSCAFYEGAGDEWLENQLVFTGHGGGRVKVWRKMSTLDGRWTLELLRQLDHGGKDKAAGITCI
APTPSSLYTGDDDGRVFEWSFGRGER*
Coding >Ophcf2|03886
ATGGCCTTTTCTCTTCGACGTCGCCGGGGCTCTACCTTGCACTCGCAGCAGCCGACGTCGGACTCTTACAACGTG
CTATGCGGCCTGCTCGACAGCCTCAGCGACGAAGCCGCCTCTTTGGGGGCCGACGGATACCCTCGAGTCGACAGC
CTCGTCAAGGACCTCAAACTTGTTACCCGCCATGTCACCCAGTCGCCGTCTTCTTCAGCCTGTGCAGATGGCTTT
CGACACGCCCACGGCTTCGAGTCCGTCCTCGCCGTTCTCCGCTGTTTTTCAGGCTACTATGACCCCCACAAGAGA
GACGAGTGCGACATGTTGTCCCTGTTTGACCTGCTGGGCGCCAGCCTCGATCTTCTATCGGTCGTTCTGAGGGAC
CGACCAGCAAACAAGCGATTTTTCTGTCATGGCGTCGAGGGTGGCGGATGGGAGGCTCTCGAACAGGTCATCGCC
AGCATCGGCCTTGGCGGCGCTGAGCTAGATCCTTGGGTCAGTTGCAACGTCTTCGGAAAGCTGCTTTCTTTTTCC
CTCGACGATGACAGCCTCGACCTTCTCTGCCAGTCCGTCGCCAAGGCGCTGCGCCCCGAAGCTGCTGTCAGCGCG
AGCCACTCCCAAGATGACGAGCAGTGGGAGCTCGTTCTGTCTCGCTCGATCGAGAACGTCGGTCCCGCCGTGCGA
GAAGTGGTCACTTCCGGCACCATAGTACGCTTTCCAGAGATTCTCAGAGCAGTCGTCAGCTTCTGGACGGCGATT
CCGCGGCCTCATGGCTCGTCGGCGAGTCCAAGCTCCGTTTTGGTGTTGGAAACGTTACTTCGAGTCGTCTCAGTT
TCCTTCTACAACCGCGCTGCCGTCCACTCGACCGGAGTCTTGTCCCAGCTATTGCGAGTCACTTTTGGACAAGAC
ATCTGGCTGGCCGAGCCCGAACGTGAGAGGCTGCCAGCCATCTGCCGGCTGCTCATGGCTCTCGGCGTGAATGAG
CCAGCTGATACACAGTTTCTTCTCTCGGCCCAAGGAACGGCGGCCTCCGAATTCTGCCTCGAGATAATGTCTGAG
CATACAGGTCCGCCATTCTTCCAGTTCGACCTGTCCTTATGCGGCTACTCGGCCCTCGAGCTTCCTAGTCTCGGT
CGATCGTTTCCTCCGCAGTCGAGTGCCGGCTACACGTTTGCCGCTTGGGTTCGCGTTGAAACGTTCGACCCGTCC
GCCCATACAACCATGTTTGGCCTCTACGACTCCTCGCAGACCTGCTTCTTGCTGCTGTATCTGGAACGAGACACC
CGGAACGTCATCCTTCAAACCTCTATCCATTCCAGCAAGCCGAGTGTCAGGTTCAAGTCCGTGGTATTTCACGAA
CACAAGTGGTATCATATCGCTGTCGTTCACCGGAGGCCCAAGACTATGACGGCCAGCAAGGCGCTGCTGTACGTC
AATGGAGATTTTGCCGAGCAGGTCCGCTGCAGCTACCCTCGCTCGCCGCCTATCATGAATGGCAGCGTCGAGAGC
TTCACGTCTCTGAATCCTAGTCAGAGCAGGTCGAGCTCCGTCCAGGCCTTTCTCGGCACGCCTCGAGACCTGGCT
GGCCGTACAGGCCCGGGAGTCGTTCAGTCCAGATGGTCGCTCGCTTCGGCGCACCTTTTCGAAGATACGATGAGC
GATGACTACCTGGCCGTTCACTACGGCCTTGGACCTCGTTATCAGGGCAACTTTCAAGACAGCCTCGGAGGCTTT
CAGACATACGAGGCGTCAGCAGCTTTGGGCCTGCGTAACGAGCTGGTGCACCCGGGCAAGGACGAGAACTCGGAC
ATTCTCCGAGCTGTGCGCGACAAGGCGAGCTCCCTACTGCCGGAGTCCAGAATTCTTCTCAGCGCTCTACCCGTC
GGCACCTTTCCCGAACACGTGCAGTTTCTCGATACCGGCGTCTTGCGATCGTTGCCTCGCATATCTGTGCGCAAC
CTCGTTCAGATGTCCAACAAGGAGGGCACTCCGCTGGCCGTCAACTGCGCAGTCTCAAGCCTGTCGGATGCCCTC
ATGAGGACCAGCGGAGTCGCTTCTCTCAGCGGAAGCCCCATCGTTGCCCTGCCGTCTCACCTGGACGAAAATCTC
TGGCGCCTCGCCGGCTTTACGCCTCTGGCCCTCAAGTTGCTGGAGAGGGCTTCCACCACGGAGGAGCTCATCCGC
GCAGTCGAGATAATGTTTCACAGTATCCGCAGGAGTTGGCGCAACAGCGAAGCCATGGAGAGAGACAATGGTTAT
TGCATACTCGGCATGATTCTCCGCTTCAAGATTGGCTATGCCTCGGGCGAGGGACCCATCTCTCGTCTCTCGATA
TCAAACGAGGAACGCGACAGCCTGACATTTCGGTTGCTGAGCCTCATACTCGGCTTTGTCGGCTACAAGCACGTG
GAGCCCATCGAGTCCTTCATCGTCAACCCGCTCGCCTACCGGATCCTCCTCATCGATCTAGACATCTGGCGACGA
GCTGCCCACCGCACCCAGGAGCTCTTTTACAAGCAGTTTGTGACGTTTGCCGTCAATAGCAAGCATCACGAGTTT
AACAACCGAAGGTTGATCCGCATGCGGGTGGTCAAGAGGTTACTCGACTCCACCAAGGGGGAGGGAGTGTCGGAG
CAAATCGTCCATCACTTCATGAGTGCTTTTGAAGCGCTCGTCAAGTCGAACCTCAGCCAGGAAGTTATGAGATAC
CTGTCGCTGTTCATCACCTACGCCTTTCACACCTCGCCACCGTCGGCATCGCGGACGCCAAAAGCACCGTCGGCA
TCCCAGCTGAGCATCTCGGGACTTGCGAGGCAACTGACAGGGGATGTCCCCAGGGCGCGCAGTCCTTCGGCGCCC
GATACCAGGGTGTTATCCAAGAAGCAGCTGGGCATTCGCGTGCTGGCCTTGTATGCTGGGATTCTTTGCGAGAAG
AACAACTTTAATAATATTAAGAGATTCGCAAGAACCGTCACCAACAAGTGGCTGCTGTATCTGCTGGCGGATGAC
GATGCCTCCGTCGTCCTCCACGGGTCCATGATTCTGTCCAGGCTGCTAGTGGCCCACGGATCTTCTTACACGTCC
AAGTTTACTGGAAAGTCCGGCGGTTTCATCGTCATGGCTGCTCGTCTGAAGAGGTTCTGGGACATACCCACGGTC
TGGGCAATATGCTTCAGCATCATGTTCGGGTACGACATTGCCGAGCTGGACCTTGATCGTCCCTTTGACGTGGAC
AACCTGCTCGATATCTTTGGCCGGCGAAAGGTGGTCTATCCCGAATTCCTGGCCGTCATAAGATCCTTGCTCCAG
CACGGCGTCAAGGAAGTCATGAGGCATCAGGAAGACCCAGACTCGCCTGCCAAGGTAGACGGCTCGCTCGCCGCA
ATGAGAGCTAAGCCAAAGTCCGAGACGGGCCTTCGGGTGATGTCTATGAATCCGACCAAGGCGATTGAAGCGCGA
ACGAGTCTATCTGATCCCTACGATGGTGTCAGCGGGCGTGCTGCCGTCCTGCAGACGTCGATTCGCTTCCTGCAA
GAGCTTCACGCCCGGTCATCCAGCTTCCGTGACTTCTGCCTATCGTCGGAATGGGTACGCACTCTGCTCTTGGTC
CTGTATCCCGCCATGGTTGGCACGGACGCGGTCACGCCCGAGGTCGAGCTGAATTCGAGAGATTCGGTTCTCACG
TTTGAGGGCAGCGACGTCATCATCAGACCCATCTCCGGCGTCCAGACTGCTGCGCCCATTGTCCGCACGAGTCGG
GTCGACGTGGTGCCTTCGCCTCAGGCTACACCTCCGAGGGCAACTCCTCTCCGACGGGCGTCCTCGTTTGTCCTT
CTGACGGCACAGAAGGCGCCCCGCGTCGAGGATCGTCTTCCCGCCTTGTCGCCGCAGTTGCAGGCTCGGCAGAGC
AGTGGCGGTATCGTCTCCGAAGGGATTCTGGACTTGTTAGTCGCAATCTTCATGGATCAGATCTTCACGCGCAGG
GACTTCGTCGGCCTCGGTCTCTCCAGCAATGTGCCTCCGGGGTTTCAGGAGCATCAGGCCTACCTCGAGTCGCAA
ATACTCAAGAGGGTCATGTGTCGCGTGTCGGATCACATTCACGCCAACAAGAAGACCATCTGCGAGCCGCGCGTT
CTAACCAACCTATCGCGTCTCTGCTCGCAAATGTCAGAGGCTATATTCGAAGGCTGGTTCATGGACGGGGCCGAA
GTCATGATCGACTTCAACGGCATGTTGCTGGAGCAGCTGCAGCGGCCCGACATCGGCAGGATGAAGAGCGTGCGG
CTCTGCAGCCAGGCCGTTGCTGTGATCCGCGGCTGTTTCCTCAGGATCATCCTGTTGAAGCTCTCGGACCTGGAC
AACGCTCGAATCACGGAGAGAGAGGCCAAGGATTTCATGAATATGCTCGCCTACTGGCAAATGTCGATACTCGAG
TGCTTCACCTTGGAAGACGAGTACATGAGGCTGTTCTGGTATCAGCTCTACACCAAGCTCATCGACGACAGACGG
TCAATACGAATCGCCGCAGCCAACTTTCTGCGCATCGTTCTGGTGCAGAAACCGGAGCAGTCTGTTGCTATGGTT
CGATCGGGCTCGGGGCCGGACCAGAAGAAGCTCTGTCGCGAGTTTCAGAAGCTCACCGAGGTGGATGACGATACA
TTTGTCGCCTGGGTAGATCAGCATCGTCCTTCGCTCGACGGTCTCTTCCTCGGTAACATGGCCAAGACGTGGGAG
GACTTTGTCGGTCTGGAGTACCAGAAGTCGCTCGAAGGCGCGAGGAACCGCGCGTCGAGGCGCAAGGAGCGTCTC
AGGGCGTGGAACGTCGAGGCCCTCAGCACGGACAAGGTCCTCGTCAACCACGAGGTGGGCAACAGCGCGTGGATG
AAGAGCATCTACAACACGGAGCACTTCAAGTACCAGCGCCTCCTGCAGGACCAGCAGGACGACCTTTCCTTTCTC
ATGGCCGGCTACAGCAAGATGGAGAGGGACCTCAGGAGGCCGGGCGCCGTCTTCAGCGAGCCGGCGCCGGTCAAA
TGGAAGCTGGACCGGACTGAGGGGCGCAACAGGATGCGGCTGAGGTTGCTCCCGGACTCACCCGCGACCGAGGAG
AAGTACCGGCCGAAGCGGAAGGTGGCCGAAGCGCGGGCATCGGGGCCGGGAGTAACGGCGGTCAACACGGAGGCC
AAGACGGCTGTCAAGACGGCGGTCGGCTTCCCGGCCCCTAACGGGGATCCCGAGCCGAGCCTGGAACTCGACGGC
AACGACGAGTCTTCGTCTCTCAACGCCGAGGCCGCGTCGACGGCGGAATCGGCTTGCGCTACCGACGACGACTTT
GAGCTCGTGCAGGATCCCAACGAGGGAGACGAGAACTTTGAAGACAAGAACCGCAAGGTGATGCGGCGGCTCGAA
CCGGGCGAGCAGGTCCAGGCGGCCTACAACATGTCTCGTATCACGGGCCTTGAGGCCTGCGAGGGTCTCCTCATC
GTCGGCAAGGACGCGCTCTACATCATGGACAATGTGTTTCAGTGCGCGAGCGGAGAGATAGTCGACGTCTGGCAA
GCACCCGCAGACGAGCGTGACCCTTTCAGCATGGTGGTGACGGGGGCCAAGACGCTGGAGAGACGACAGAACTCG
GGGGCCCGGGATCAGGAGTCGAGACACTGGCGGTGGCACGATGTCATCAGCGTCTCCAAGCGACGCTTCCTCTTC
CGGGACGTTGCCATCGAGGTCTTCTTCACCGACGGGCGGAGCTACCTCCTGACGACGATCAAGGCGGCCGTCAGA
GACGAGCTGTTCGCCAAGATGGTGACCAAGGCGGGAGCCAAGGCGGTGCTCAACGGCGAAGAAGGCTGGCGGCTG
GAGACGCTCAAGACGGCGGACAACGAGCTCCCGCAGAGCTTCGGCGCCGGACTGGGCTCCAAGCTGGGCACGCTG
TTCAACGCGGTCCCTTGGAACCCTGCGATGCGGAGGTGGCAACGGGGAGAGCTATCCAACTTTCACTACCTCATG
ATGGTCAACACCATGGCCGGACGGACCTTTAACGACCTGACGCAGTACCCGGTCTTCCCCTGGATCCTGGCCGAC
TACAGCAGCGAAGAGCTGGACCTGGACGATCCGGCCACCTTCCGCGACCTGAGCAAGCCCATGGGCGGCCAGACA
CAGGGTCGAGTGGCGGGCTTCGTCGAGACGTACAAGGCGCTGCAGGAGATTGGCCAGACGCCGTTTCATTACGGC
ACGCACTACTCTTCGGCCATGATTGTGTCGTCGTATCTGATCCGTCTGCCGCCCTTTGTTCAGTCGTATCTGCTG
GTTCAGGGCGACAGCTTCGATCACGCCGACAGGCTGTTCCAGTCCGTTGGCGACGCCTGGGAGTCGGCCTCGCGC
CGGAACAAGACGGACGTCCGGGAGCTGATTCCCGAGTTCTTTTGCCTGCCCGACTTCCTGACCAACATCAACGGC
TACGACTTTGGTCATCGGCAGAGCAACGGCGTCAAGGTGGACAACGTGGCTCTGCCCCCGTGGGCCAAGGGCGAT
GCCCGCATCTTCATCGCCAAGCACCGCGAAGCTCTCGAGAGTCGATACGTCAGCGAGAACTTACACCATTGGATC
GATCTCGTCTTCGGCTGCAAGCAGAGAGGCGAGGCAGCGGTCGAGAGCATCAACGTCTTTCACCACCTGTCATAC
GCCGGTGCCAGCGACCTGGACCGCATCACCGACGCCAACGAAAGGGCTATAACCGCCGGCGTCATTCACAACTTT
GGCCAGACGCCGCACCAAGTGTTTAGCAAGCCGCATCCCGCCAGGGATCATTTCCGCTGTCCTATCCGGAGGCTC
GACACGGCCGTCTCGTCCCTGAGCCGGCCGGACCATCCGATGCTGGAGAGCCATGAGCGGGTGGCTTCGTTGGTG
TACGTGACCAAGTCAGATCGACTGCTCTGTGCCTCGCCGCTGCGCCTCAACTTTCCGCCTTACGACAAGTTCCTC
GAATGGGGCTACGCCGACGGCAGCATCCGCTTCTTCTTCAGCGACAACCGCAAGCCGGCCGGGCTGTTCGAAAAC
CTGCACATTGGGCAAATCTCGTGCGCCTGCTTCGCCGACTCCAAGACGCTCATCACAGCGGGCGAGGACTGCGTC
GTCTCCGTTTACTCCGTCGTCACCTCGCTGGGCAAGCAGGTAGAGCTCGTGCCGCGGTCCAGCGTCTTCGGCCAC
AAGACGCCCGTGACGGCCATGGCGGTCAGCAGAGCGCTGAGCACCTTTGTGACGGCCTCTTCGGATGGTCAGGCG
TTTCTATGGGATCTGAACCGCCTGTCTTTTATCCGCAAGCTGCCGTTGGTGAGACAGGTCGAGTGTGCGCGCATC
AACGACGTATCGGGCGACGTCATGCTCTGCTCCGGACCTTATGTGGTGCTGTACACTCTCAACGGGTCGCTGCTG
CTGGAGCAAAAGGTGTGCGAAGGTGAGGACTACCTTCACTCGTGCGCCTTTTACGAGGGCGCCGGCGACGAGTGG
CTGGAGAACCAGCTCGTCTTTACGGGCCACGGCGGTGGACGCGTCAAAGTCTGGCGAAAGATGTCGACACTCGAT
GGCCGATGGACGCTCGAGCTTCTCCGGCAGCTGGATCACGGTGGAAAGGACAAGGCGGCGGGCATCACATGCATC
GCGCCCACGCCGAGCAGTCTTTACACCGGGGATGACGACGGCCGAGTGTTTGAATGGAGCTTCGGACGCGGCGAG
AGATAG
Transcript >Ophcf2|03886
ATGGCCTTTTCTCTTCGACGTCGCCGGGGCTCTACCTTGCACTCGCAGCAGCCGACGTCGGACTCTTACAACGTG
CTATGCGGCCTGCTCGACAGCCTCAGCGACGAAGCCGCCTCTTTGGGGGCCGACGGATACCCTCGAGTCGACAGC
CTCGTCAAGGACCTCAAACTTGTTACCCGCCATGTCACCCAGTCGCCGTCTTCTTCAGCCTGTGCAGATGGCTTT
CGACACGCCCACGGCTTCGAGTCCGTCCTCGCCGTTCTCCGCTGTTTTTCAGGCTACTATGACCCCCACAAGAGA
GACGAGTGCGACATGTTGTCCCTGTTTGACCTGCTGGGCGCCAGCCTCGATCTTCTATCGGTCGTTCTGAGGGAC
CGACCAGCAAACAAGCGATTTTTCTGTCATGGCGTCGAGGGTGGCGGATGGGAGGCTCTCGAACAGGTCATCGCC
AGCATCGGCCTTGGCGGCGCTGAGCTAGATCCTTGGGTCAGTTGCAACGTCTTCGGAAAGCTGCTTTCTTTTTCC
CTCGACGATGACAGCCTCGACCTTCTCTGCCAGTCCGTCGCCAAGGCGCTGCGCCCCGAAGCTGCTGTCAGCGCG
AGCCACTCCCAAGATGACGAGCAGTGGGAGCTCGTTCTGTCTCGCTCGATCGAGAACGTCGGTCCCGCCGTGCGA
GAAGTGGTCACTTCCGGCACCATAGTACGCTTTCCAGAGATTCTCAGAGCAGTCGTCAGCTTCTGGACGGCGATT
CCGCGGCCTCATGGCTCGTCGGCGAGTCCAAGCTCCGTTTTGGTGTTGGAAACGTTACTTCGAGTCGTCTCAGTT
TCCTTCTACAACCGCGCTGCCGTCCACTCGACCGGAGTCTTGTCCCAGCTATTGCGAGTCACTTTTGGACAAGAC
ATCTGGCTGGCCGAGCCCGAACGTGAGAGGCTGCCAGCCATCTGCCGGCTGCTCATGGCTCTCGGCGTGAATGAG
CCAGCTGATACACAGTTTCTTCTCTCGGCCCAAGGAACGGCGGCCTCCGAATTCTGCCTCGAGATAATGTCTGAG
CATACAGGTCCGCCATTCTTCCAGTTCGACCTGTCCTTATGCGGCTACTCGGCCCTCGAGCTTCCTAGTCTCGGT
CGATCGTTTCCTCCGCAGTCGAGTGCCGGCTACACGTTTGCCGCTTGGGTTCGCGTTGAAACGTTCGACCCGTCC
GCCCATACAACCATGTTTGGCCTCTACGACTCCTCGCAGACCTGCTTCTTGCTGCTGTATCTGGAACGAGACACC
CGGAACGTCATCCTTCAAACCTCTATCCATTCCAGCAAGCCGAGTGTCAGGTTCAAGTCCGTGGTATTTCACGAA
CACAAGTGGTATCATATCGCTGTCGTTCACCGGAGGCCCAAGACTATGACGGCCAGCAAGGCGCTGCTGTACGTC
AATGGAGATTTTGCCGAGCAGGTCCGCTGCAGCTACCCTCGCTCGCCGCCTATCATGAATGGCAGCGTCGAGAGC
TTCACGTCTCTGAATCCTAGTCAGAGCAGGTCGAGCTCCGTCCAGGCCTTTCTCGGCACGCCTCGAGACCTGGCT
GGCCGTACAGGCCCGGGAGTCGTTCAGTCCAGATGGTCGCTCGCTTCGGCGCACCTTTTCGAAGATACGATGAGC
GATGACTACCTGGCCGTTCACTACGGCCTTGGACCTCGTTATCAGGGCAACTTTCAAGACAGCCTCGGAGGCTTT
CAGACATACGAGGCGTCAGCAGCTTTGGGCCTGCGTAACGAGCTGGTGCACCCGGGCAAGGACGAGAACTCGGAC
ATTCTCCGAGCTGTGCGCGACAAGGCGAGCTCCCTACTGCCGGAGTCCAGAATTCTTCTCAGCGCTCTACCCGTC
GGCACCTTTCCCGAACACGTGCAGTTTCTCGATACCGGCGTCTTGCGATCGTTGCCTCGCATATCTGTGCGCAAC
CTCGTTCAGATGTCCAACAAGGAGGGCACTCCGCTGGCCGTCAACTGCGCAGTCTCAAGCCTGTCGGATGCCCTC
ATGAGGACCAGCGGAGTCGCTTCTCTCAGCGGAAGCCCCATCGTTGCCCTGCCGTCTCACCTGGACGAAAATCTC
TGGCGCCTCGCCGGCTTTACGCCTCTGGCCCTCAAGTTGCTGGAGAGGGCTTCCACCACGGAGGAGCTCATCCGC
GCAGTCGAGATAATGTTTCACAGTATCCGCAGGAGTTGGCGCAACAGCGAAGCCATGGAGAGAGACAATGGTTAT
TGCATACTCGGCATGATTCTCCGCTTCAAGATTGGCTATGCCTCGGGCGAGGGACCCATCTCTCGTCTCTCGATA
TCAAACGAGGAACGCGACAGCCTGACATTTCGGTTGCTGAGCCTCATACTCGGCTTTGTCGGCTACAAGCACGTG
GAGCCCATCGAGTCCTTCATCGTCAACCCGCTCGCCTACCGGATCCTCCTCATCGATCTAGACATCTGGCGACGA
GCTGCCCACCGCACCCAGGAGCTCTTTTACAAGCAGTTTGTGACGTTTGCCGTCAATAGCAAGCATCACGAGTTT
AACAACCGAAGGTTGATCCGCATGCGGGTGGTCAAGAGGTTACTCGACTCCACCAAGGGGGAGGGAGTGTCGGAG
CAAATCGTCCATCACTTCATGAGTGCTTTTGAAGCGCTCGTCAAGTCGAACCTCAGCCAGGAAGTTATGAGATAC
CTGTCGCTGTTCATCACCTACGCCTTTCACACCTCGCCACCGTCGGCATCGCGGACGCCAAAAGCACCGTCGGCA
TCCCAGCTGAGCATCTCGGGACTTGCGAGGCAACTGACAGGGGATGTCCCCAGGGCGCGCAGTCCTTCGGCGCCC
GATACCAGGGTGTTATCCAAGAAGCAGCTGGGCATTCGCGTGCTGGCCTTGTATGCTGGGATTCTTTGCGAGAAG
AACAACTTTAATAATATTAAGAGATTCGCAAGAACCGTCACCAACAAGTGGCTGCTGTATCTGCTGGCGGATGAC
GATGCCTCCGTCGTCCTCCACGGGTCCATGATTCTGTCCAGGCTGCTAGTGGCCCACGGATCTTCTTACACGTCC
AAGTTTACTGGAAAGTCCGGCGGTTTCATCGTCATGGCTGCTCGTCTGAAGAGGTTCTGGGACATACCCACGGTC
TGGGCAATATGCTTCAGCATCATGTTCGGGTACGACATTGCCGAGCTGGACCTTGATCGTCCCTTTGACGTGGAC
AACCTGCTCGATATCTTTGGCCGGCGAAAGGTGGTCTATCCCGAATTCCTGGCCGTCATAAGATCCTTGCTCCAG
CACGGCGTCAAGGAAGTCATGAGGCATCAGGAAGACCCAGACTCGCCTGCCAAGGTAGACGGCTCGCTCGCCGCA
ATGAGAGCTAAGCCAAAGTCCGAGACGGGCCTTCGGGTGATGTCTATGAATCCGACCAAGGCGATTGAAGCGCGA
ACGAGTCTATCTGATCCCTACGATGGTGTCAGCGGGCGTGCTGCCGTCCTGCAGACGTCGATTCGCTTCCTGCAA
GAGCTTCACGCCCGGTCATCCAGCTTCCGTGACTTCTGCCTATCGTCGGAATGGGTACGCACTCTGCTCTTGGTC
CTGTATCCCGCCATGGTTGGCACGGACGCGGTCACGCCCGAGGTCGAGCTGAATTCGAGAGATTCGGTTCTCACG
TTTGAGGGCAGCGACGTCATCATCAGACCCATCTCCGGCGTCCAGACTGCTGCGCCCATTGTCCGCACGAGTCGG
GTCGACGTGGTGCCTTCGCCTCAGGCTACACCTCCGAGGGCAACTCCTCTCCGACGGGCGTCCTCGTTTGTCCTT
CTGACGGCACAGAAGGCGCCCCGCGTCGAGGATCGTCTTCCCGCCTTGTCGCCGCAGTTGCAGGCTCGGCAGAGC
AGTGGCGGTATCGTCTCCGAAGGGATTCTGGACTTGTTAGTCGCAATCTTCATGGATCAGATCTTCACGCGCAGG
GACTTCGTCGGCCTCGGTCTCTCCAGCAATGTGCCTCCGGGGTTTCAGGAGCATCAGGCCTACCTCGAGTCGCAA
ATACTCAAGAGGGTCATGTGTCGCGTGTCGGATCACATTCACGCCAACAAGAAGACCATCTGCGAGCCGCGCGTT
CTAACCAACCTATCGCGTCTCTGCTCGCAAATGTCAGAGGCTATATTCGAAGGCTGGTTCATGGACGGGGCCGAA
GTCATGATCGACTTCAACGGCATGTTGCTGGAGCAGCTGCAGCGGCCCGACATCGGCAGGATGAAGAGCGTGCGG
CTCTGCAGCCAGGCCGTTGCTGTGATCCGCGGCTGTTTCCTCAGGATCATCCTGTTGAAGCTCTCGGACCTGGAC
AACGCTCGAATCACGGAGAGAGAGGCCAAGGATTTCATGAATATGCTCGCCTACTGGCAAATGTCGATACTCGAG
TGCTTCACCTTGGAAGACGAGTACATGAGGCTGTTCTGGTATCAGCTCTACACCAAGCTCATCGACGACAGACGG
TCAATACGAATCGCCGCAGCCAACTTTCTGCGCATCGTTCTGGTGCAGAAACCGGAGCAGTCTGTTGCTATGGTT
CGATCGGGCTCGGGGCCGGACCAGAAGAAGCTCTGTCGCGAGTTTCAGAAGCTCACCGAGGTGGATGACGATACA
TTTGTCGCCTGGGTAGATCAGCATCGTCCTTCGCTCGACGGTCTCTTCCTCGGTAACATGGCCAAGACGTGGGAG
GACTTTGTCGGTCTGGAGTACCAGAAGTCGCTCGAAGGCGCGAGGAACCGCGCGTCGAGGCGCAAGGAGCGTCTC
AGGGCGTGGAACGTCGAGGCCCTCAGCACGGACAAGGTCCTCGTCAACCACGAGGTGGGCAACAGCGCGTGGATG
AAGAGCATCTACAACACGGAGCACTTCAAGTACCAGCGCCTCCTGCAGGACCAGCAGGACGACCTTTCCTTTCTC
ATGGCCGGCTACAGCAAGATGGAGAGGGACCTCAGGAGGCCGGGCGCCGTCTTCAGCGAGCCGGCGCCGGTCAAA
TGGAAGCTGGACCGGACTGAGGGGCGCAACAGGATGCGGCTGAGGTTGCTCCCGGACTCACCCGCGACCGAGGAG
AAGTACCGGCCGAAGCGGAAGGTGGCCGAAGCGCGGGCATCGGGGCCGGGAGTAACGGCGGTCAACACGGAGGCC
AAGACGGCTGTCAAGACGGCGGTCGGCTTCCCGGCCCCTAACGGGGATCCCGAGCCGAGCCTGGAACTCGACGGC
AACGACGAGTCTTCGTCTCTCAACGCCGAGGCCGCGTCGACGGCGGAATCGGCTTGCGCTACCGACGACGACTTT
GAGCTCGTGCAGGATCCCAACGAGGGAGACGAGAACTTTGAAGACAAGAACCGCAAGGTGATGCGGCGGCTCGAA
CCGGGCGAGCAGGTCCAGGCGGCCTACAACATGTCTCGTATCACGGGCCTTGAGGCCTGCGAGGGTCTCCTCATC
GTCGGCAAGGACGCGCTCTACATCATGGACAATGTGTTTCAGTGCGCGAGCGGAGAGATAGTCGACGTCTGGCAA
GCACCCGCAGACGAGCGTGACCCTTTCAGCATGGTGGTGACGGGGGCCAAGACGCTGGAGAGACGACAGAACTCG
GGGGCCCGGGATCAGGAGTCGAGACACTGGCGGTGGCACGATGTCATCAGCGTCTCCAAGCGACGCTTCCTCTTC
CGGGACGTTGCCATCGAGGTCTTCTTCACCGACGGGCGGAGCTACCTCCTGACGACGATCAAGGCGGCCGTCAGA
GACGAGCTGTTCGCCAAGATGGTGACCAAGGCGGGAGCCAAGGCGGTGCTCAACGGCGAAGAAGGCTGGCGGCTG
GAGACGCTCAAGACGGCGGACAACGAGCTCCCGCAGAGCTTCGGCGCCGGACTGGGCTCCAAGCTGGGCACGCTG
TTCAACGCGGTCCCTTGGAACCCTGCGATGCGGAGGTGGCAACGGGGAGAGCTATCCAACTTTCACTACCTCATG
ATGGTCAACACCATGGCCGGACGGACCTTTAACGACCTGACGCAGTACCCGGTCTTCCCCTGGATCCTGGCCGAC
TACAGCAGCGAAGAGCTGGACCTGGACGATCCGGCCACCTTCCGCGACCTGAGCAAGCCCATGGGCGGCCAGACA
CAGGGTCGAGTGGCGGGCTTCGTCGAGACGTACAAGGCGCTGCAGGAGATTGGCCAGACGCCGTTTCATTACGGC
ACGCACTACTCTTCGGCCATGATTGTGTCGTCGTATCTGATCCGTCTGCCGCCCTTTGTTCAGTCGTATCTGCTG
GTTCAGGGCGACAGCTTCGATCACGCCGACAGGCTGTTCCAGTCCGTTGGCGACGCCTGGGAGTCGGCCTCGCGC
CGGAACAAGACGGACGTCCGGGAGCTGATTCCCGAGTTCTTTTGCCTGCCCGACTTCCTGACCAACATCAACGGC
TACGACTTTGGTCATCGGCAGAGCAACGGCGTCAAGGTGGACAACGTGGCTCTGCCCCCGTGGGCCAAGGGCGAT
GCCCGCATCTTCATCGCCAAGCACCGCGAAGCTCTCGAGAGTCGATACGTCAGCGAGAACTTACACCATTGGATC
GATCTCGTCTTCGGCTGCAAGCAGAGAGGCGAGGCAGCGGTCGAGAGCATCAACGTCTTTCACCACCTGTCATAC
GCCGGTGCCAGCGACCTGGACCGCATCACCGACGCCAACGAAAGGGCTATAACCGCCGGCGTCATTCACAACTTT
GGCCAGACGCCGCACCAAGTGTTTAGCAAGCCGCATCCCGCCAGGGATCATTTCCGCTGTCCTATCCGGAGGCTC
GACACGGCCGTCTCGTCCCTGAGCCGGCCGGACCATCCGATGCTGGAGAGCCATGAGCGGGTGGCTTCGTTGGTG
TACGTGACCAAGTCAGATCGACTGCTCTGTGCCTCGCCGCTGCGCCTCAACTTTCCGCCTTACGACAAGTTCCTC
GAATGGGGCTACGCCGACGGCAGCATCCGCTTCTTCTTCAGCGACAACCGCAAGCCGGCCGGGCTGTTCGAAAAC
CTGCACATTGGGCAAATCTCGTGCGCCTGCTTCGCCGACTCCAAGACGCTCATCACAGCGGGCGAGGACTGCGTC
GTCTCCGTTTACTCCGTCGTCACCTCGCTGGGCAAGCAGGTAGAGCTCGTGCCGCGGTCCAGCGTCTTCGGCCAC
AAGACGCCCGTGACGGCCATGGCGGTCAGCAGAGCGCTGAGCACCTTTGTGACGGCCTCTTCGGATGGTCAGGCG
TTTCTATGGGATCTGAACCGCCTGTCTTTTATCCGCAAGCTGCCGTTGGTGAGACAGGTCGAGTGTGCGCGCATC
AACGACGTATCGGGCGACGTCATGCTCTGCTCCGGACCTTATGTGGTGCTGTACACTCTCAACGGGTCGCTGCTG
CTGGAGCAAAAGGTGTGCGAAGGTGAGGACTACCTTCACTCGTGCGCCTTTTACGAGGGCGCCGGCGACGAGTGG
CTGGAGAACCAGCTCGTCTTTACGGGCCACGGCGGTGGACGCGTCAAAGTCTGGCGAAAGATGTCGACACTCGAT
GGCCGATGGACGCTCGAGCTTCTCCGGCAGCTGGATCACGGTGGAAAGGACAAGGCGGCGGGCATCACATGCATC
GCGCCCACGCCGAGCAGTCTTTACACCGGGGATGACGACGGCCGAGTGTTTGAATGGAGCTTCGGACGCGGCGAG
AGATAG
Gene >Ophcf2|03886
ATGGCCTTTTCTCTTCGACGTCGCCGGGGCTCTACCTTGCACTCGCAGCAGCCGACGTCGGACTCTTACAACGTG
CTATGCGGCCTGCTCGACAGCCTCAGCGACGAAGCCGCCTCTTTGGGGGCCGACGGATACCCTCGAGTCGACAGC
CTCGTCAAGGACCTCAAACTTGTTACCCGCCATGTCACCCAGTCGCCGTCTTCTTCAGCCTGTGCAGATGGCTTT
CGACACGCCCACGGCTTCGAGTCCGTCCTCGCCGTTCTCCGCTGTTTTTCAGGCTACTATGACCCCCACAAGAGA
GACGAGTGCGACATGTTGTCCCTGTTTGACCTGCTGGGCGCCAGCCTCGATCTTCTATCGGTCGTTCTGAGGGAC
CGACCAGCAAACAAGCGATTTTTCTGTCATGGCGTCGAGGGTGGCGGATGGGAGGCTCTCGAACAGGTCATCGCC
AGCATCGGCCTTGGCGGCGCTGAGCTAGATCCTTGGGTCAGTTGCAACGTCTTCGGAAAGCTGCTTTCTTTTTCC
CTCGACGATGACAGCCTCGACCTTCTCTGCCAGTCCGTCGCCAAGGCGCTGCGCCCCGAAGCTGCTGTCAGCGCG
AGCCACTCCCAAGATGACGAGCAGTGGGAGCTCGTTCTGTCTCGCTCGATCGAGAACGTCGGTCCCGCCGTGCGA
GAAGTGGTCACTTCCGGCACCATAGTACGCTTTCCAGAGATTCTCAGAGCAGTCGTCAGCTTCTGGACGGCGATT
CCGCGGCCTCATGGCTCGTCGGCGAGTCCAAGCTCCGTTTTGGTGTTGGAAACGTTACTTCGAGTCGTCTCAGTT
TCCTTCTACAACCGCGCTGCCGTCCACTCGACCGGAGTCTTGTCCCAGCTATTGCGAGTCACTTTTGGACAAGAC
ATCTGGCTGGCCGAGCCCGAACGTGAGAGGCTGCCAGCCATCTGCCGGCTGCTCATGGCTCTCGGCGTGAATGAG
CCAGCTGATACACAGTTTCTTCTCTCGGCCCAAGGAACGGCGGCCTCCGAATTCTGCCTCGAGATAATGTCTGAG
CATACAGGTCCGCCATTCTTCCAGTTCGACCTGTCCTTATGCGGCTACTCGGCCCTCGAGCTTCCTAGTCTCGGT
CGATCGTTTCCTCCGCAGTCGAGTGCCGGCTACACGTTTGCCGCTTGGGTTCGCGTTGAAACGTTCGACCCGTCC
GCCCATACAACCATGTTTGGCCTCTACGACTCCTCGCAGACCTGCTTCTTGCTGCTGTATCTGGAACGAGACACC
CGGAACGTCATCCTTCAAACCTCTATCCATTCCAGCAAGCCGAGTGTCAGGTTCAAGTCCGTGGTATTTCACGAA
CACAAGTGGTATCATATCGCTGTCGTTCACCGGAGGCCCAAGACTATGACGGCCAGCAAGGCGCTGCTGTACGTC
AATGGAGATTTTGCCGAGCAGGTCCGCTGCAGCTACCCTCGCTCGCCGCCTATCATGAATGGCAGCGTCGAGAGC
TTCACGTCTCTGAATCCTAGTCAGAGCAGGTCGAGCTCCGTCCAGGCCTTTCTCGGCACGCCTCGAGACCTGGCT
GGCCGTACAGGCCCGGGAGTCGTTCAGTCCAGATGGTCGCTCGCTTCGGCGCACCTTTTCGAAGATACGATGAGC
GATGACTACCTGGCCGTTCACTACGGCCTTGGACCTCGTTATCAGGGCAACTTTCAAGACAGCCTCGGAGGCTTT
CAGACATACGAGGCGTCAGCAGCTTTGGGCCTGCGTAACGAGCTGGTGCACCCGGGCAAGGACGAGAACTCGGAC
ATTCTCCGAGCTGTGCGCGACAAGGCGAGCTCCCTACTGCCGGAGTCCAGAATTCTTCTCAGCGCTCTACCCGTC
GGCACCTTTCCCGAACACGTGCAGTTTCTCGATACCGGCGTCTTGCGATCGTTGCCTCGCATATCTGTGCGCAAC
CTCGTTCAGATGTCCAACAAGGAGGGCACTCCGCTGGCCGTCAACTGCGCAGTCTCAAGCCTGTCGGATGCCCTC
ATGAGGACCAGCGGAGTCGCTTCTCTCAGCGGAAGCCCCATCGTTGCCCTGCCGTCTCACCTGGACGAAAATCTC
TGGCGCCTCGCCGGCTTTACGCCTCTGGCCCTCAAGTTGCTGGAGAGGGCTTCCACCACGGAGGAGCTCATCCGC
GCAGTCGAGATAATGTTTCACAGTATCCGCAGGAGTTGGCGCAACAGCGAAGCCATGGAGAGAGACAATGGTTAT
TGCATACTCGGCATGATTCTCCGCTTCAAGATTGGCTATGCCTCGGGCGAGGGACCCATCTCTCGTCTCTCGATA
TCAAACGAGGAACGCGACAGCCTGACATTTCGGTTGCTGAGCCTCATACTCGGCTTTGTCGGCTACAAGCACGTG
GAGCCCATCGAGTCCTTCATCGTCAACCCGCTCGCCTACCGGATCCTCCTCATCGATCTAGACATCTGGCGACGA
GCTGCCCACCGCACCCAGGAGCTCTTTTACAAGCAGTTTGTGACGTTTGCCGTCAATAGCAAGCATCACGAGTTT
AACAACCGAAGGTTGATCCGCATGCGTAAGTCGTTGCCTCTTCTCCCCATCCGCCGTCGTTCCAGGGCTGACTGT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTTTCCGTTCAGGGGTGGTCAAGAGGTTACTCGACTCCACCAAGGGGGA
GGGAGTGTCGGAGCAAATCGTCCATCACTTCATGAGTGCTTTTGAAGCGCTCGTCAAGTCGAACCTCAGCCAGGA
AGTTATGAGATACCTGTCGCTGTTCATCACCTACGCCTTTCACACCTCGCCACCGTCGGCATCGCGGACGCCAAA
AGCACCGTCGGCATCCCAGCTGAGCATCTCGGGACTTGCGAGGCAACTGACAGGGGATGTCCCCAGGGCGCGCAG
TCCTTCGGCGCCCGATACCAGGGTGTTATCCAAGAAGCAGCTGGGCATTCGCGTGCTGGCCTTGTATGCTGGGAT
TCTTTGCGAGAAGAACAACTTTAATAATATTAAGAGATTCGCAAGAACCGTCACCAACAAGGTAAGTGTGGCTGA
ATTCCGGCGGCAAGGACGACTATATTAATCTCTGCAGTGGCTGCTGTATCTGCTGGCGGATGACGATGCCTCCGT
CGTCCTCCACGGGTCCATGATTCTGTCCAGGCTGCTAGTGGCCCACGGATCTTCTTACACGTCCAAGTTTACTGG
AAAGTCCGGCGGTTTCATCGTCATGGCTGCTCGTCTGAAGAGGTTCTGGGACATACCCACGGTCTGGGCAATATG
CTTCAGCATCATGTTCGGGTACGACATTGCCGAGCTGGACCTTGATCGTCCCTTTGACGTGGACAACCTGCTCGA
TATCTTTGGCCGGCGAAAGGTGGTCTATCCCGAATTCCTGGCCGTCATAAGATCCTTGCTCCAGCACGGCGTCAA
GGAAGTCATGAGGCATCAGGAAGACCCAGACTCGCCTGCCAAGGTAGACGGCTCGCTCGCCGCAATGAGAGCTAA
GCCAAAGTCCGAGACGGGCCTTCGGGTGATGTCTATGAATCCGACCAAGGCGATTGAAGCGCGAAGTGAGTTCGG
CTCTACTTGTTGAACCAACGAATCTGTCTGACGGCTCTCCAGCGAGTCTATCTGATCCCTACGATGGTGTCAGCG
GGCGTGCTGCCGTCCTGCAGACGTCGATTCGCTTCCTGCAAGAGCTTCACGCCCGGTCATCCAGCTTCCGTGACT
TCTGCCTATCGTCGGAATGGGTACGCACTCTGCTCTTGGTCCTGTATCCCGCCATGGTTGGCACGGACGCGGTCA
CGCCCGAGGTCGAGCTGAATTCGAGAGATTCGGTTCTCACGTTTGAGGGCAGCGACGTCATCATCAGACCCATCT
CCGGCGTCCAGACTGCTGCGCCCATTGTCCGCACGAGTCGGGTCGACGTGGTGCCTTCGCCTCAGGCTACACCTC
CGAGGGCAACTCCTCTCCGACGGGCGTCCTCGTTTGTCCTTCTGACGGCACAGAAGGCGCCCCGCGTCGAGGATC
GTCTTCCCGCCTTGTCGCCGCAGTTGCAGGCTCGGCAGAGCAGTGGCGGTATCGTCTCCGAAGGGATTCTGGACT
TGTTAGTCGCAATCTTCATGGATCAGATCTTCACGCGCAGGGACTTCGTCGGCCTCGGTCTCTCCAGCAATGTGC
CTCCGGGGTTTCAGGAGCATCAGGCCTACCTCGAGTCGCAAATACTCAAGAGGGTCATGTGTCGCGTGTCGGATC
ACATTCACGCCAACAAGAAGACCATCTGCGAGCCGCGCGTTCTAACCAACCTATCGCGTCTCTGCTCGCAAATGT
CAGAGGCTATATTCGAAGGCTGGTTCATGGACGGGGCCGAAGTCATGATCGACTTCAACGGCATGTTGCTGGAGC
AGCTGCAGCGGCCCGACATCGGCAGGATGAAGAGCGTGCGGCTCTGCAGCCAGGCCGTTGCTGTGATCCGCGGCT
GTTTCCTCAGGATCATCCTGTTGAAGCTCTCGGACCTGGACAACGCTCGAATCACGGAGAGAGAGGCCAAGGATT
TCATGAATATGCTCGCCTACTGGCAAATGTCGATACTCGAGTGCTTCACCTTGGAAGACGAGTACATGAGGCTGT
TCTGGTATCAGCTCTACACCAAGCTCATCGACGACAGACGGTCAATACGAATCGCCGCAGCCAACTTTCTGCGCA
TCGTTCTGGTGCAGAAACCGGAGCAGTCTGTTGCTATGGTTCGATCGGGCTCGGGGCCGGACCAGAAGAAGCTCT
GTCGCGAGTTTCAGAAGCTCACCGAGGTGGATGACGATACATTTGTCGCCTGGGTAGATCAGCATCGTCCTTCGC
TCGACGGTCTCTTCCTCGGTAACATGGCCAAGACGTGGGAGGACTTTGTCGGTCTGGAGTACCAGAAGTCGCTCG
AAGGCGCGAGGAACCGCGCGTCGAGGCGCAAGGAGCGTCTCAGGGCGTGGAACGTCGAGGCCCTCAGCACGGACA
AGGTCCTCGTCAACCACGAGGTGGGCAACAGCGCGTGGATGAAGAGCATCTACAACACGGAGCACTTCAAGTACC
AGCGCCTCCTGCAGGACCAGCAGGACGACCTTTCCTTTCTCATGGCCGGCTACAGCAAGATGGAGAGGGACCTCA
GGAGGCCGGGCGCCGTCTTCAGCGAGCCGGCGCCGGTCAAATGGAAGCTGGACCGGACTGAGGGGCGCAACAGGA
TGCGGCTGAGGTTGCTCCCGGACTCACCCGCGACCGAGGAGAAGTACCGGCCGAAGCGGAAGGTGGCCGAAGCGC
GGGCATCGGGGCCGGGAGTAACGGCGGTCAACACGGAGGCCAAGACGGCTGTCAAGACGGCGGTCGGCTTCCCGG
CCCCTAACGGGGATCCCGAGCCGAGCCTGGAACTCGACGGCAACGACGAGTCTTCGTCTCTCAACGCCGAGGCCG
CGTCGACGGCGGAATCGGCTTGCGCTACCGACGACGACTTTGAGCTCGTGCAGGATCCCAACGAGGGAGACGAGA
ACTTTGAAGACAAGAACCGCAAGGTGATGCGGCGGCTCGAACCGGGCGAGCAGGTCCAGGCGGCCTACAACATGT
CTCGTATCACGGGCCTTGAGGCCTGCGAGGGTCTCCTCATCGTCGGCAAGGACGCGCTCTACATCATGGACAATG
TGTTTCAGTGCGCGAGCGGAGAGATAGTCGACGTCTGGCAAGCACCCGCAGACGAGCGTGACCCTTTCAGCATGG
TGGTGACGGGGGCCAAGACGCTGGAGAGACGACAGAACTCGGGGGCCCGGGATCAGGAGTCGAGACACTGGCGGT
GGCACGATGTCATCAGCGTCTCCAAGCGACGCTTCCTCTTCCGGGACGTTGCCATCGAGGTCTTCTTCACCGACG
GGCGGAGCTACCTCCTGACGACGATCAAGGCGGCCGTCAGAGACGAGCTGTTCGCCAAGATGGTGACCAAGGCGG
GAGCCAAGGCGGTGCTCAACGGCGAAGAAGGCTGGCGGCTGGAGACGCTCAAGACGGCGGACAACGAGCTCCCGC
AGAGCTTCGGCGCCGGACTGGGCTCCAAGCTGGGCACGCTGTTCAACGCGGTCCCTTGGAACCCTGCGATGCGGA
GGTGGCAACGGGGAGAGCTATCCAACTTTCACTACCTCATGATGGTCAACACCATGGCCGGACGGACCTTTAACG
ACCTGACGCAGTACCCGGTCTTCCCCTGGATCCTGGCCGACTACAGCAGCGAAGAGCTGGACCTGGACGATCCGG
CCACCTTCCGCGACCTGAGCAAGCCCATGGGCGGCCAGACACAGGGTCGAGTGGCGGGCTTCGTCGAGACGTACA
AGGCGCTGCAGGAGATTGGCCAGACGCCGTTTCATTACGGCACGCACTACTCTTCGGCCATGATTGTGTCGTCGT
ATCTGATCCGTCTGCCGCCCTTTGTTCAGTCGTATCTGCTGGTTCAGGGCGACAGCTTCGATCACGCCGACAGGC
TGTTCCAGTCCGTTGGCGACGCCTGGGAGTCGGCCTCGCGCCGGAACAAGACGGACGTCCGGGAGCTGATTCCCG
AGTTCTTTTGCCTGCCCGACTTCCTGACCAACATCAACGGCTACGACTTTGGTCATCGGCAGAGCAACGGCGTCA
AGGTGGACAACGTGGCTCTGCCCCCGTGGGCCAAGGGCGATGCCCGCATCTTCATCGCCAAGCACCGCGAAGCTC
TCGAGAGTCGATACGTCAGCGAGAACTTACACCATTGGATCGATCTCGTCTTCGGCTGCAAGCAGAGAGGCGAGG
CAGCGGTCGAGAGCATCAACGTCTTTCACCACCTGTCATACGCCGGTGCCAGCGACCTGGACCGCATCACCGACG
CCAACGAAAGGGCTATAACCGCCGGCGTCATTCACAACTTTGGCCAGACGCCGCACCAAGTGTTTAGCAAGCCGC
ATCCCGCCAGGGATCATTTCCGCTGTCCTATCCGGAGGCTCGACACGGCCGTCTCGTCCCTGAGCCGGCCGGACC
ATCCGATGCTGGGTGAGCAACGAGTTGAAAGTTCCTTGACGTATACCATGTTGACGACTGACGGATGAGCAACAG
AGAGCCATGAGCGGGTGGCTTCGTTGGTGTACGTGACCAAGTCAGATCGACTGCTCTGTGCCTCGCCGCTGCGCC
TCAACTTTCCGCCTTACGACAAGTTCCTCGAATGGGGCTACGCCGACGGCAGCATCCGCTTCTTCTTCAGCGACA
ACCGCAAGGTGAGACATGTCCGGGATGACGAGGGGGGAAAAAGGGGGTAAACTGACCGGAGAACAATCAGCCGGC
CGGGCTGTTCGAAAACCTGCACATTGGGCAAATCTCGTGCGCCTGCTTCGCCGACTCCAAGACGCTCATCACAGC
GGGCGAGGACTGCGTCGTCTCCGTTTACTCCGTCGTCACCTCGCTGGGCAAGCAGGTAGAGCTCGTGCCGCGGTC
CAGCGTCTTCGGCCACAAGACGCCCGTGACGGCCATGGCGGTCAGCAGAGCGCTGAGCACCTTTGTGACGGCCTC
TTCGGATGGTCAGGCGTTTCTATGGGATCTGAACCGCCTGTCTTTTATCCGCAAGCTGCCGTTGGTGAGACAGGT
CGAGTGTGCGCGCATCAACGACGTATCGGGCGACGTCATGCTCTGCTCCGGACCTTATGTGGTGCTGTACACTCT
CAACGGGTCGCTGCTGCTGGAGCAAAAGGTGTGCGAAGGTGAGGACTACCTTCACTCGTGCGCCTTTTACGAGGG
CGCCGGCGACGAGTGGCTGGAGAACCAGCTCGTCTTTACGGGCCACGGCGGTGGACGCGTCAAAGTCTGGCGAAA
GATGTCGACACTCGATGGCCGATGGACGCTCGAGCTTCTCCGGCAGCTGGATCACGGTGGAAAGGACAAGGCGGC
GGGCATCACATGCATCGCGCCCACGCCGAGCAGTCTTTACACCGGGGATGACGACGGCCGAGTGGTGAGTTTTCG
GGGCGCTGGTTGCGTGAAGAGAGAAGAGCGGGCGATGCTGACGTTGGTGACAGTTTGAATGGAGCTTCGGACGCG
GCGAGAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail