Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03882
Gene name
Locationscaffold_04:231350..234180
Strand-
Gene length (bp)2830
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7012 0.4522 0.2359 0.135 0.397 0.2124 0.1992 0.2107 0.2659 0.0524

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1915
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|660
Ophiocordyceps australis map64 (Brazil) OphauB2|4579
Ophiocordyceps camponoti-floridani Ophcf2|03882 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|144
Ophiocordyceps kimflemingae Ophio5|1625
Ophiocordyceps subramaniannii Hirsu2|201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03882
MTYLPRAKPGAATWVNGQKKKKRLLSPRLGAARAKPPETMSYYDSPQWSGPAQNNWDHQGAAAAAPARAAGASGP
QPQDDFAYSYQFDEVDRAYENLQKSGKGYAMGGRRPDLRVSHGAVPRSHPVNTFDEARGSQPPSLHTFYASQRHQ
PSRGNNEAEQFMQSKRRMAAQRERELRNRHTEQQYQRNDLTEPAQHGNKHMSEEETRELIARQRSALYGEGPFAD
KSSYVDESGNIRPGAPRPSGPPSLRGPSPLTFDGIGRASSGPDATSPASIADHAATAGAGPSPRPQSTTSPQTSG
KPLDGAVGTQSRTSSSSPTRASPPRDLAPGSKSGQHSTIVAPIGTRPSASSSSATATGKRSTTPLTSPGGWGRGN
GVWGQSSGLGAQASVWG*
Coding >Ophcf2|03882
ATGACTTACCTACCTCGGGCCAAGCCGGGCGCTGCGACGTGGGTAAACGGACAAAAAAAAAAAAAAAGATTGCTC
TCGCCCCGACTGGGCGCTGCGCGTGCGAAGCCACCAGAAACCATGTCCTACTACGACAGTCCTCAGTGGTCTGGC
CCTGCCCAGAATAATTGGGATCATCAGGGCGCCGCCGCTGCCGCTCCTGCTCGTGCTGCAGGTGCCAGCGGTCCC
CAGCCTCAGGATGACTTTGCCTATTCCTACCAGTTTGACGAGGTCGACCGCGCCTATGAGAATCTTCAAAAGTCC
GGCAAGGGTTATGCTATGGGTGGACGCCGCCCCGACCTCCGAGTCTCCCACGGTGCCGTCCCGCGCTCTCACCCC
GTCAACACCTTCGATGAGGCTCGCGGCTCTCAGCCACCCAGTCTTCATACCTTTTACGCTTCTCAGCGACATCAG
CCCTCGCGGGGAAACAACGAAGCCGAGCAGTTCATGCAGTCCAAGAGAAGGATGGCAGCACAGCGGGAACGGGAA
CTGCGAAACCGACACACGGAGCAGCAATATCAACGAAATGACTTGACCGAACCCGCCCAACATGGAAACAAGCAC
ATGTCAGAAGAGGAGACGCGAGAGCTCATCGCCCGCCAGCGCAGCGCCCTCTACGGAGAGGGCCCCTTCGCCGAC
AAGAGTAGCTACGTCGATGAATCGGGCAACATTCGACCGGGCGCACCGCGCCCCAGCGGTCCTCCCAGCCTGCGC
GGACCCTCCCCTCTGACTTTTGACGGCATCGGACGCGCCTCCTCCGGCCCGGACGCTACCTCTCCGGCTTCGATA
GCCGACCACGCCGCCACCGCCGGCGCCGGCCCCAGCCCGCGTCCGCAGAGTACCACCAGCCCGCAGACTTCCGGA
AAGCCCCTTGACGGTGCTGTCGGAACCCAGAGCCGCACCAGCTCTTCGAGCCCAACGCGAGCATCTCCTCCTCGC
GACCTTGCTCCGGGGTCCAAGTCGGGCCAGCACTCGACCATCGTCGCCCCCATTGGCACGCGCCCTTCCGCCTCG
TCGTCGTCGGCTACTGCTACCGGAAAGCGCTCCACCACCCCTCTCACTTCGCCGGGAGGCTGGGGCCGCGGCAAC
GGTGTCTGGGGCCAATCTTCGGGTCTCGGCGCCCAGGCCAGCGTCTGGGGCTGA
Transcript >Ophcf2|03882
ATGACTTACCTACCTCGGGCCAAGCCGGGCGCTGCGACGTGGGTAAACGGACAAAAAAAAAAAAAAAGATTGCTC
TCGCCCCGACTGGGCGCTGCGCGTGCGAAGCCACCAGAAACCATGTCCTACTACGACAGTCCTCAGTGGTCTGGC
CCTGCCCAGAATAATTGGGATCATCAGGGCGCCGCCGCTGCCGCTCCTGCTCGTGCTGCAGGTGCCAGCGGTCCC
CAGCCTCAGGATGACTTTGCCTATTCCTACCAGTTTGACGAGGTCGACCGCGCCTATGAGAATCTTCAAAAGTCC
GGCAAGGGTTATGCTATGGGTGGACGCCGCCCCGACCTCCGAGTCTCCCACGGTGCCGTCCCGCGCTCTCACCCC
GTCAACACCTTCGATGAGGCTCGCGGCTCTCAGCCACCCAGTCTTCATACCTTTTACGCTTCTCAGCGACATCAG
CCCTCGCGGGGAAACAACGAAGCCGAGCAGTTCATGCAGTCCAAGAGAAGGATGGCAGCACAGCGGGAACGGGAA
CTGCGAAACCGACACACGGAGCAGCAATATCAACGAAATGACTTGACCGAACCCGCCCAACATGGAAACAAGCAC
ATGTCAGAAGAGGAGACGCGAGAGCTCATCGCCCGCCAGCGCAGCGCCCTCTACGGAGAGGGCCCCTTCGCCGAC
AAGAGTAGCTACGTCGATGAATCGGGCAACATTCGACCGGGCGCACCGCGCCCCAGCGGTCCTCCCAGCCTGCGC
GGACCCTCCCCTCTGACTTTTGACGGCATCGGACGCGCCTCCTCCGGCCCGGACGCTACCTCTCCGGCTTCGATA
GCCGACCACGCCGCCACCGCCGGCGCCGGCCCCAGCCCGCGTCCGCAGAGTACCACCAGCCCGCAGACTTCCGGA
AAGCCCCTTGACGGTGCTGTCGGAACCCAGAGCCGCACCAGCTCTTCGAGCCCAACGCGAGCATCTCCTCCTCGC
GACCTTGCTCCGGGGTCCAAGTCGGGCCAGCACTCGACCATCGTCGCCCCCATTGGCACGCGCCCTTCCGCCTCG
TCGTCGTCGGCTACTGCTACCGGAAAGCGCTCCACCACCCCTCTCACTTCGCCGGGAGGCTGGGGCCGCGGCAAC
GGTGTCTGGGGCCAATCTTCGGGTCTCGGCGCCCAGGCCAGCGTCTGGGGCTGA
Gene >Ophcf2|03882
ATGACTTACCTACCTCGGGCCAAGCCGGGCGCTGCGACGTGGGTAAACGTCTGTGGGTTTTTCCTCATCCTCCCT
GGGAGACAGACGAGAACAAGAGAATGGGCCGGTCCGATCCGTCTCAGGAGTGACGTATGTATGTATGTGTATGTA
TGTACGTATGCACATAGCTTCACCGAACCGCTGAGCTTTATTAGAACAACCTCAGTTCAACGGCCAGCCTCGACG
GGGCTCGAGCTCAGGGCCGAAGCGCGGCGGGCCGACGAGGCGGCGTCGGGCTGGATACGTGCCTGCGGATGGATG
GCTGCGCGCTGGAGAGACATCCATGATGATGGTGTCAGAGTGGTCCGCCCAGGGGGGGCGTGTGGCGCCGTCGGA
AAAGCACTGTGTCGTCACGACCTCGACGCATACAGCCCACAGTGCCCGCTTCCTGATCCATACTATTCTCCTCCT
CTGGAAATTTCTAACCCCCCCCCCCTCTCTCTCCTCCCCCAATCCCCTCCCCGCCCACGCACGCTCACCTTCTTC
CCCGTCCCTCGTCTCTCCGATTCCTTCTCGTCTCTCGCGCCTCTCTTTCGCCCTCCCCCCCCCCCTTCCCTTGTT
CCCTCTGCGCCTCAGTCACGAGGGCTTCTTTTTATTTTCGGGATTCTTTCTTACCTGCCACTGACGAGGACGACG
AGGACTAATCCGCCCTCCGCGACTGGTGTTTTTTTTTTCTTCCACACGCCTGTCAGCGACGCACGCCGTCTCTCC
TTTCGTCTTGTCCGTCGGCAGTGGCGTTCGCTCCTAAATTTTTTTTTTTTCGGCCCTTAACGACCACCCTTAAAC
CCGCATAGGGGGTCTCGAGCGCTTCGCCAGACTGACCTCTACCCCCACTCCCGCTCTCTTCTTCTCTTTTCTTTC
TCTCGGCGCTCTTTTTGCCCCCTTTCTTCCCTCCCCCTCCCCAAAGCGCACCCCGCTGCGCGTCCCTCCGCCCGG
TGTCTTGCCCATCGACATCATACATATTATTCTACAGAGGAAAAAAGAATTAAAAGGGACAAAAAAAAAAAAAAA
GGTCAGTTTATTTTCTCATCCCAGCCTGTGATGCCATCCATCGCCCCGCTGCTCGTCGCGTGGCCATGTCCTTCG
TCTGTCTTCTCCATCGCCCCAAAACCAGGTCCGCCGCACCGCTTCCACGGCCCGTCTCTACCCGTCGCTACACTC
TTGTTTTTTTCGGGGGTTTTTTGGGGGGGTTTTTTTTTTTTTTAAATTTTTGCTGGGCCATCTCCTCTCGAGTCG
TGTCCTGCTTTTCTCCATCTCGTTCTCGTCGGCTCATCTTCGCAAGCAGATTGCTCTCGCCCCGACTGGGCGCTG
CGCGTGCGAAGCCACCAGAAACCATGTCCTACTACGACAGTCCTCAGTGGTCTGGCCCTGCCCAGAATAATTGGG
ATCATCAGGGCGCCGCCGCTGCCGCTCCTGCTCGTGCTGGTACGAGCTGCTCACATCACCTATCTGCGTCTGCTT
CATCGATTTAATTCCCGTGTTCAGCAGGTGCCAGCGGTCCCCAGCCTCAGGATGACTTTGCCTATTCCTACCAGT
TTGACGGTATGTCTGCGTCGCCTCTGTTTTTTGGGGTCTCTCAGATCACTGACCCGTGCTTCACCGTGATGAAGA
GGTCGACCGCGCCTATGAGAATCTTCAAAAGTCCGGCAAGGGTTATGCTATGGGTGGACGCCGTGAGTATTAGCT
CAAATCCCCCGTACTCTCAGGCTCACTCCCGTCACGGGCCTCACTCCGATGAGGCACCATCCACTGACCGACCCT
GACACAGGCCCCGACCTCCGAGTCTCCCACGGTGCCGTCCCGCGCTCTCACCCCGTCAACACCTTCGATGAGGCT
CGCGGCTCTCAGCCACCCAGTCTTCATACCTTTTACGCTTCTCAGCGACATCAGCCCTCGCGGGGAAACAACGAA
GCCGAGCAGTTCATGCAGTCCAAGAGAAGGATGGCAGCACAGCGGGAACGGGAACTGCGAAACCGACACACGGAG
CAGCAATATCAACGAAGTATGCCGCCCTCAACTGTTTAGCCTTGACGCATCCCATCGAAAATATTCATCCCCTCT
TCCCTTGTTTTACACCCAAGAGAAATAGATTCGAAGCGCCGACGTCTCTTGATCATGGCCAAGGCCTCTGGCTGC
TCTTTTCGAATGTATGCTAACCTTCGTCTCCAACGTAGATGACTTGACCGAACCCGCCCAACATGGAAACAAGCA
CATGTCAGAAGAGGAGACGCGAGAGCTCATCGCCCGCCAGCGCAGCGCCCTCTACGGAGAGGGCCCCTTCGCCGA
CAAGAGTAGCTACGTCGATGAATCGGGCAACATTCGACCGGGCGCACCGCGCCCCAGCGGTCCTCCCAGCCTGCG
CGGACCCTCCCCTCTGACTTTTGACGGCATCGGACGCGCCTCCTCCGGCCCGGACGCTACCTCTCCGGCTTCGAT
AGCCGACCACGCCGCCACCGCCGGCGCCGGCCCCAGCCCGCGTCCGCAGAGTACCACCAGCCCGCAGACTTCCGG
AAAGCCCCTTGACGGTGCTGTCGGAACCCAGAGCCGCACCAGCTCTTCGAGCCCAACGCGAGCATCTCCTCCTCG
CGACCTTGCTCCGGGGTCCAAGTCGGGCCAGCACTCGACCATCGTCGCCCCCATTGGCACGCGCCCTTCCGCCTC
GTCGTCGTCGGCTACTGCTACCGGAAAGCGCTCCACCACCCCTCTCACTTCGCCGGGAGGCTGGGGCCGCGGCAA
CGGTGTCTGGGGCCAATCTTCGGGTCTCGGCGCCCAGGCCAGCGTCTGGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail