Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03877
Gene name
Locationscaffold_04:215991..217648
Strand+
Gene length (bp)1657
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06027 SLC35F Solute carrier family 35 1.3E-92 171 463
PF08627 CRT-like CRT-like, chloroquine-resistance transporter-like 2.1E-06 232 353

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 4 21 17
2 170 192 22
3 202 224 22
4 237 259 22
5 264 286 22
6 295 314 19
7 329 351 22
8 358 376 18
9 391 413 22
10 420 442 22
11 447 469 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 63.39 36.45 90.34
Alive In ants, during behavior modification 36.59 20.11 53.07
Dead In ants, recently dead 40.02 22.23 57.80

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.002793 yes
Alive Dead 0.654597 no
Dead Fungus 0.013485 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03877
MAIIVVVVVVVVVVIIIVNSSPKSSTLVCGIISPIRLHFNIPLLPPSIVSPPDPTCPALDNQPASDLKSLRLPCS
QKTLSPSSNDNVPSGFRREASHDDNHHVESRLPRTTSTEDAAPSSPPRAPSPSFEPPRDADAQAAAAAAAAAAGI
ALLESRRPKRWYGYVTSADFCLVAFLGQVLALCITATNTFTTLLARADFNAPALQTCFNYAFIAAVFTTVFLVRD
GPHAWFRALRSRGWRYLLLAALDVEANYFTVLAYQHTTILSAQLINFWSIVCVVAVSALVLKVRYRPQQLLGILV
CCAGMGLLIATDHLGQRNGGPANDALRGDLFALLGATLYGLSNVFEEWLVSKDAAHHVLAFLGLFGLIINGVQAA
IFDRATLAKTVWSGPIAGWLVGYTACLSLFYSLAPLVLRMASAAFFDVSLLTANFWGVIIGVRLFGYGVHFLYPL
AFLCIVAGLVLYFVAGSSLGDAQKPWLARDQHDGVAGLGTAKLRAINAARGPPAGVWERVRRGFGVE*
Coding >Ophcf2|03877
ATGGCCATCATTGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCATCATCATCGTAAACAGCTCTCCCAAGTCGTCA
ACTCTTGTATGTGGTATCATATCCCCCATCAGACTTCACTTCAACATCCCCCTCCTCCCTCCCAGCATCGTCAGC
CCTCCGGATCCCACATGTCCAGCTCTAGATAACCAGCCGGCAAGCGACTTGAAGTCTTTGCGCTTGCCCTGCTCT
CAAAAGACTCTCTCTCCCTCCTCCAACGATAATGTCCCTTCCGGCTTCCGACGCGAAGCAAGCCACGACGATAAC
CACCACGTCGAATCTCGTCTCCCCCGGACGACATCGACAGAAGATGCCGCCCCGAGCTCCCCGCCCCGAGCTCCC
AGCCCCTCTTTCGAACCCCCCCGCGATGCAGACGCCCAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGGAATC
GCCCTCTTGGAAAGCAGACGGCCCAAACGATGGTACGGCTACGTGACCTCTGCCGACTTTTGCCTCGTCGCCTTC
CTCGGTCAGGTCCTCGCGCTATGCATCACGGCGACGAACACTTTCACCACGCTACTCGCACGCGCGGACTTCAAC
GCCCCCGCTTTGCAGACGTGCTTCAACTACGCCTTCATCGCCGCCGTCTTCACCACCGTCTTCCTCGTCCGTGAC
GGACCGCACGCCTGGTTCCGAGCCCTACGCTCACGTGGATGGCGATACTTGTTGCTCGCAGCCCTCGACGTCGAG
GCGAATTACTTCACCGTCCTCGCCTACCAGCACACGACGATCCTATCGGCGCAGCTCATCAACTTCTGGTCCATC
GTCTGCGTAGTCGCCGTCTCGGCCCTCGTCCTCAAGGTCCGCTACCGCCCGCAGCAACTCCTAGGCATCCTCGTC
TGCTGCGCCGGAATGGGCCTCCTCATCGCTACCGATCACCTAGGCCAGCGCAACGGCGGTCCCGCCAACGACGCC
CTCCGCGGCGACCTCTTCGCCCTCCTGGGCGCCACCCTCTACGGCCTCAGCAACGTCTTCGAGGAATGGCTCGTC
AGCAAGGACGCAGCCCACCACGTACTCGCCTTCCTCGGCCTCTTCGGCCTCATCATCAACGGCGTCCAAGCCGCC
ATCTTCGACCGAGCCACCCTGGCCAAGACGGTCTGGTCCGGTCCGATAGCCGGCTGGTTAGTCGGCTACACGGCC
TGCCTCTCGCTCTTCTACTCGCTGGCGCCGCTGGTGCTGCGAATGGCCAGCGCCGCCTTCTTCGACGTGTCTCTC
CTGACGGCCAATTTCTGGGGCGTCATCATCGGCGTGCGGCTGTTCGGCTACGGCGTGCACTTCCTATACCCGCTG
GCTTTCCTGTGCATCGTCGCCGGCCTCGTCTTGTACTTTGTGGCGGGGAGCTCGCTGGGTGACGCGCAGAAGCCG
TGGCTCGCGCGCGATCAGCACGATGGGGTCGCCGGTTTGGGGACGGCCAAGTTGAGGGCCATCAACGCGGCGAGG
GGGCCGCCTGCTGGGGTTTGGGAGCGGGTGAGGAGGGGGTTTGGGGTTGAGTGA
Transcript >Ophcf2|03877
ATGGCCATCATTGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCATCATCATCGTAAACAGCTCTCCCAAGTCGTCA
ACTCTTGTATGTGGTATCATATCCCCCATCAGACTTCACTTCAACATCCCCCTCCTCCCTCCCAGCATCGTCAGC
CCTCCGGATCCCACATGTCCAGCTCTAGATAACCAGCCGGCAAGCGACTTGAAGTCTTTGCGCTTGCCCTGCTCT
CAAAAGACTCTCTCTCCCTCCTCCAACGATAATGTCCCTTCCGGCTTCCGACGCGAAGCAAGCCACGACGATAAC
CACCACGTCGAATCTCGTCTCCCCCGGACGACATCGACAGAAGATGCCGCCCCGAGCTCCCCGCCCCGAGCTCCC
AGCCCCTCTTTCGAACCCCCCCGCGATGCAGACGCCCAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCGGGAATC
GCCCTCTTGGAAAGCAGACGGCCCAAACGATGGTACGGCTACGTGACCTCTGCCGACTTTTGCCTCGTCGCCTTC
CTCGGTCAGGTCCTCGCGCTATGCATCACGGCGACGAACACTTTCACCACGCTACTCGCACGCGCGGACTTCAAC
GCCCCCGCTTTGCAGACGTGCTTCAACTACGCCTTCATCGCCGCCGTCTTCACCACCGTCTTCCTCGTCCGTGAC
GGACCGCACGCCTGGTTCCGAGCCCTACGCTCACGTGGATGGCGATACTTGTTGCTCGCAGCCCTCGACGTCGAG
GCGAATTACTTCACCGTCCTCGCCTACCAGCACACGACGATCCTATCGGCGCAGCTCATCAACTTCTGGTCCATC
GTCTGCGTAGTCGCCGTCTCGGCCCTCGTCCTCAAGGTCCGCTACCGCCCGCAGCAACTCCTAGGCATCCTCGTC
TGCTGCGCCGGAATGGGCCTCCTCATCGCTACCGATCACCTAGGCCAGCGCAACGGCGGTCCCGCCAACGACGCC
CTCCGCGGCGACCTCTTCGCCCTCCTGGGCGCCACCCTCTACGGCCTCAGCAACGTCTTCGAGGAATGGCTCGTC
AGCAAGGACGCAGCCCACCACGTACTCGCCTTCCTCGGCCTCTTCGGCCTCATCATCAACGGCGTCCAAGCCGCC
ATCTTCGACCGAGCCACCCTGGCCAAGACGGTCTGGTCCGGTCCGATAGCCGGCTGGTTAGTCGGCTACACGGCC
TGCCTCTCGCTCTTCTACTCGCTGGCGCCGCTGGTGCTGCGAATGGCCAGCGCCGCCTTCTTCGACGTGTCTCTC
CTGACGGCCAATTTCTGGGGCGTCATCATCGGCGTGCGGCTGTTCGGCTACGGCGTGCACTTCCTATACCCGCTG
GCTTTCCTGTGCATCGTCGCCGGCCTCGTCTTGTACTTTGTGGCGGGGAGCTCGCTGGGTGACGCGCAGAAGCCG
TGGCTCGCGCGCGATCAGCACGATGGGGTCGCCGGTTTGGGGACGGCCAAGTTGAGGGCCATCAACGCGGCGAGG
GGGCCGCCTGCTGGGGTTTGGGAGCGGGTGAGGAGGGGGTTTGGGGTTGAGTGA
Gene >Ophcf2|03877
ATGGCCATCATTGTCGTCGTCGTCGTCGTCGTCGTCGTCGTCATCATCATCGTAAACAGCTCTCCCAAGTCGTCA
ACTCTTGTATGTGGTATCATGTATGTATGCATCTAACCCCCCCCCACCTACGGGTACTCAGATCCCTCCTCCCCA
CCACCACACAATCCATCATGATGCCATCCGCTGACTCAGCAAACCCAGATCCCCCATCAGACTTCACTTCAACAT
CCCCCTCCTCCCTCCCAGCATCGTCAGCCCTCCGGATCCCACATGTCCAGCTCTAGATAACCAGCCGGCAAGCGA
CTTGAAGTCTTTGCGCTTGCCCTGCTCTCAAAAGACTCTCTCTCCCTCCTCCAACGATAATGTCCCTTCCGGCTT
CCGACGCGAAGCAAGCCACGACGATAACCACCACGTCGAATCTCGTCTCCCCCGGACGACATCGACAGAAGATGC
CGCCCCGAGCTCCCCGCCCCGAGCTCCCAGCCCCTCTTTCGAACCCCCCCGCGATGCAGACGCCCAAGCAGCAGC
AGCAGCAGCAGCAGCAGCAGCGGGAATCGCCCTCTTGGAAAGCAGACGGCCCAAACGATGGTACGGCTACGTGAC
CTCTGCCGACTTTTGCCTCGTCGCCTTCCTCGGTCAGGTCCTCGCGCTATGCATCACGGCGACGAACACTTTCAC
CACGCTACTCGCACGCGCGGACTTCAACGCCCCCGCTTTGCAGACGTGCTTCAACTACGCCTTCATCGCCGCCGT
CTTCACCACCGTCTTCCTCGTCCGTGACGGACCGCACGCCTGGTTCCGAGCCCTACGCTCACGTGGATGGCGATA
CTTGTTGCTCGCAGCCCTCGACGTCGAGGCGAATTACTTCACCGTCCTCGCCTACCAGCACACGACGATCCTATC
GGCGCAGCTCATCAACTTCTGGTCCATCGTCTGCGTAGTCGCCGTCTCGGCCCTCGTCCTCAAGGTCCGCTACCG
CCCGCAGCAACTCCTAGGCATCCTCGTCTGCTGCGCCGGAATGGGCCTCCTCATCGCTACCGATCACCTAGGCCA
GCGCAACGGCGGTCCCGCCAACGACGCCCTCCGCGGCGACCTCTTCGCCCTCCTGGGCGCCACCCTCTACGGCCT
CAGCAACGTCTTCGAGGAATGGCTCGTCAGCAAGGACGCAGCCCACCACGTACTCGCCTTCCTCGGCCTCTTCGG
CCTCATCATCAACGGCGTCCAAGCCGCCATCTTCGACCGAGCCACCCTGGCCAAGACGGTCTGGTCCGGTCCGAT
AGCCGGCTGGTTAGTCGGCTACACGGCCTGCCTCTCGCTCTTCTACTCGCTGGCGCCGCTGGTGCTGCGAATGGC
CAGCGCCGCCTTCTTCGACGTGTCTCTCCTGACGGCCAATTTCTGGGGCGTCATCATCGGCGTGCGGCTGTTCGG
CTACGGCGTGCACTTCCTATACCCGCTGGCTTTCCTGTGCATCGTCGCCGGCCTCGTCTTGTACTTTGTGGCGGG
GAGCTCGCTGGGTGACGCGCAGAAGCCGTGGCTCGCGCGCGATCAGCACGATGGGGTCGCCGGTTTGGGGACGGC
CAAGTTGAGGGCCATCAACGCGGCGAGGGGGCCGCCTGCTGGGGTTTGGGAGCGGGTGAGGAGGGGGTTTGGGGT
TGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail