Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03872
Gene name
Locationscaffold_04:203402..204863
Strand-
Gene length (bp)1461
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 1.8E-29 168 354

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016209 antioxidant activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1496 0.0551 0.9299 0.1094 0.0957 0.0154 0.1237 0.0895 0.1063 0.0028

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.994191

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup10
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01575
Ophiocordyceps camponoti-floridani Ophcf2|04934
Ophiocordyceps camponoti-floridani Ophcf2|04444
Ophiocordyceps camponoti-floridani Ophcf2|03872 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01486
Ophiocordyceps camponoti-floridani Ophcf2|01298
Ophiocordyceps camponoti-rufipedis Ophun1|3812
Ophiocordyceps camponoti-rufipedis Ophun1|2843
Ophiocordyceps camponoti-rufipedis Ophun1|2652
Ophiocordyceps camponoti-rufipedis Ophun1|1703
Ophiocordyceps camponoti-rufipedis Ophun1|4097
Ophiocordyceps camponoti-rufipedis Ophun1|5039
Ophiocordyceps kimflemingae Ophio5|3515
Ophiocordyceps kimflemingae Ophio5|6027
Ophiocordyceps kimflemingae Ophio5|5537
Ophiocordyceps kimflemingae Ophio5|1636
Ophiocordyceps kimflemingae Ophio5|1831
Ophiocordyceps kimflemingae Ophio5|3860
Ophiocordyceps subramaniannii Hirsu2|176
Ophiocordyceps subramaniannii Hirsu2|2725
Ophiocordyceps subramaniannii Hirsu2|3527
Ophiocordyceps subramaniannii Hirsu2|4531
Ophiocordyceps subramaniannii Hirsu2|8567
Ophiocordyceps subramaniannii Hirsu2|4975
Ophiocordyceps subramaniannii Hirsu2|5395
Ophiocordyceps subramaniannii Hirsu2|5900
Ophiocordyceps subramaniannii Hirsu2|5920
Ophiocordyceps subramaniannii Hirsu2|7409
Ophiocordyceps subramaniannii Hirsu2|7976
Ophiocordyceps subramaniannii Hirsu2|8011
Ophiocordyceps subramaniannii Hirsu2|1636

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03872
MKAALLASLIASAASTGSAAVPRRNATSGAERDISYGPNVFVPQNNQRVSLPHRHGERLISYGPNNFVSSIFKSK
THRSPGAQVRAYKDDGNNEEGKSQHCVLRLVFQIPYIGDKLQTGGNDKPVESKKECWWIKKPANGKKPKGEAGST
YGKKEPKIDPNDPRFGNFVPRGEGDSRSSCPGLNALANHGFIPHNGKDLTMTTLIVGCYEGLGISPETSALITAD
GMSEAGIPFDTVFNLERVHSQQWGIEHDVSFGRNDSGHGDLTLLDKASWDLTLKVLDGCGYGDVPCWGKAKVARI
EQEKTRFPGSDYSKEAAAYGASEVGMLFGAFDPAIKKDNMKKCVKSLFEEEKIEMECKPDRMGADFEVVTATGVA
LLASDPVLQKGSDGMVTTAQDILAATGKGKIDLEKVVEVLRAAGFTEKKPYENMERLIAADKKIKANKDQKNGDH
N*
Coding >Ophcf2|03872
ATGAAAGCCGCTCTTCTAGCATCGTTGATCGCCTCGGCCGCTTCTACCGGCTCAGCCGCCGTTCCACGGAGAAAC
GCGACCTCGGGCGCAGAGCGAGATATCTCCTACGGCCCAAACGTCTTCGTTCCGCAGAACAACCAACGTGTAAGC
CTGCCACACAGACATGGCGAAAGGCTCATCAGCTATGGCCCCAACAACTTCGTCTCTTCCATCTTCAAGTCCAAA
ACCCATCGGTCTCCTGGTGCCCAGGTGCGGGCTTATAAGGATGATGGCAACAATGAGGAGGGAAAGTCGCAGCAC
TGCGTCCTTCGGCTCGTCTTCCAGATCCCCTATATTGGGGACAAACTTCAGACTGGCGGCAATGATAAGCCGGTA
GAGAGCAAGAAAGAGTGCTGGTGGATCAAGAAGCCGGCCAACGGCAAGAAGCCAAAAGGCGAGGCCGGGAGCACC
TACGGGAAGAAGGAGCCCAAGATCGATCCCAATGATCCGCGGTTCGGAAACTTCGTTCCCCGGGGTGAAGGAGAC
TCTCGCAGCTCGTGTCCCGGCCTAAACGCGCTGGCAAACCACGGTTTCATCCCGCACAACGGTAAGGACCTGACC
ATGACGACCCTCATCGTCGGCTGCTACGAGGGACTCGGAATCTCGCCCGAGACGTCAGCCCTCATCACGGCCGAC
GGCATGTCGGAAGCCGGCATTCCCTTCGACACCGTCTTCAACCTGGAGCGCGTTCACTCGCAGCAATGGGGCATC
GAGCACGACGTCAGCTTCGGCCGCAATGACAGCGGTCACGGTGATCTTACTCTTCTTGACAAGGCCTCCTGGGAC
CTGACCCTTAAAGTTCTCGACGGCTGCGGATATGGTGACGTTCCCTGCTGGGGCAAGGCCAAGGTGGCCCGCATC
GAGCAGGAAAAGACGCGCTTCCCGGGCTCAGACTACAGTAAGGAGGCCGCGGCCTATGGCGCCTCCGAGGTTGGC
ATGCTGTTTGGCGCCTTCGACCCGGCCATCAAGAAGGACAACATGAAGAAGTGCGTCAAGTCGCTGTTCGAGGAG
GAGAAGATTGAGATGGAGTGCAAGCCGGACCGCATGGGAGCCGACTTCGAGGTCGTGACGGCAACCGGCGTCGCC
CTCCTTGCCAGCGACCCGGTTCTGCAAAAGGGCAGCGATGGCATGGTCACCACCGCCCAGGACATCCTCGCCGCA
ACCGGAAAGGGCAAGATTGACCTCGAAAAGGTCGTCGAGGTCCTGCGTGCTGCAGGCTTCACTGAGAAGAAGCCA
TACGAGAACATGGAGCGTCTCATCGCCGCCGACAAGAAGATCAAGGCGAACAAGGACCAGAAGAACGGCGATCAC
AACTAG
Transcript >Ophcf2|03872
ATGAAAGCCGCTCTTCTAGCATCGTTGATCGCCTCGGCCGCTTCTACCGGCTCAGCCGCCGTTCCACGGAGAAAC
GCGACCTCGGGCGCAGAGCGAGATATCTCCTACGGCCCAAACGTCTTCGTTCCGCAGAACAACCAACGTGTAAGC
CTGCCACACAGACATGGCGAAAGGCTCATCAGCTATGGCCCCAACAACTTCGTCTCTTCCATCTTCAAGTCCAAA
ACCCATCGGTCTCCTGGTGCCCAGGTGCGGGCTTATAAGGATGATGGCAACAATGAGGAGGGAAAGTCGCAGCAC
TGCGTCCTTCGGCTCGTCTTCCAGATCCCCTATATTGGGGACAAACTTCAGACTGGCGGCAATGATAAGCCGGTA
GAGAGCAAGAAAGAGTGCTGGTGGATCAAGAAGCCGGCCAACGGCAAGAAGCCAAAAGGCGAGGCCGGGAGCACC
TACGGGAAGAAGGAGCCCAAGATCGATCCCAATGATCCGCGGTTCGGAAACTTCGTTCCCCGGGGTGAAGGAGAC
TCTCGCAGCTCGTGTCCCGGCCTAAACGCGCTGGCAAACCACGGTTTCATCCCGCACAACGGTAAGGACCTGACC
ATGACGACCCTCATCGTCGGCTGCTACGAGGGACTCGGAATCTCGCCCGAGACGTCAGCCCTCATCACGGCCGAC
GGCATGTCGGAAGCCGGCATTCCCTTCGACACCGTCTTCAACCTGGAGCGCGTTCACTCGCAGCAATGGGGCATC
GAGCACGACGTCAGCTTCGGCCGCAATGACAGCGGTCACGGTGATCTTACTCTTCTTGACAAGGCCTCCTGGGAC
CTGACCCTTAAAGTTCTCGACGGCTGCGGATATGGTGACGTTCCCTGCTGGGGCAAGGCCAAGGTGGCCCGCATC
GAGCAGGAAAAGACGCGCTTCCCGGGCTCAGACTACAGTAAGGAGGCCGCGGCCTATGGCGCCTCCGAGGTTGGC
ATGCTGTTTGGCGCCTTCGACCCGGCCATCAAGAAGGACAACATGAAGAAGTGCGTCAAGTCGCTGTTCGAGGAG
GAGAAGATTGAGATGGAGTGCAAGCCGGACCGCATGGGAGCCGACTTCGAGGTCGTGACGGCAACCGGCGTCGCC
CTCCTTGCCAGCGACCCGGTTCTGCAAAAGGGCAGCGATGGCATGGTCACCACCGCCCAGGACATCCTCGCCGCA
ACCGGAAAGGGCAAGATTGACCTCGAAAAGGTCGTCGAGGTCCTGCGTGCTGCAGGCTTCACTGAGAAGAAGCCA
TACGAGAACATGGAGCGTCTCATCGCCGCCGACAAGAAGATCAAGGCGAACAAGGACCAGAAGAACGGCGATCAC
AACTAG
Gene >Ophcf2|03872
ATGAAAGCCGCTCTTCTAGCATCGTTGATCGCCTCGGCCGCTTCTACCGGCTCAGCCGCCGTTCCACGGAGAAAC
GCGACCTCGGGCGCAGAGCGAGATATCTCCTACGGCCCAAACGTCTTCGTTCCGCAGAACAACCAACGTGTAAGC
CTGCCACACAGACATGGCGAAAGGCTCATCAGCTATGGCCCCAACAACTTCGTCTCTTCCATCTTCAAGTCCAAA
ACCCATCGGTCTCCTGGTGCCCAGGTGCGGGCTTATAAGGATGATGGCAACAATGAGGAGGGAAAGTCGCAGCAC
TGCGTCCTTCGGCTCGTCTTCCAGATCCCCTATATTGGGGACAAACTTCAGACTGGCGGCAATGATAAGCCGGTA
GAGAGCAAGAAAGAGTGCTGGTGGATCAAGAAGCCGGCCAACGGCAAGAAGCCAAAAGGCGAGGCCGGGAGCACC
TACGGGAAGAAGGAGCCCAAGATCGATCCCAATGATCCGCGGTTCGGAAACTTCGTTCCCCGGGGTGAAGGAGAC
TGTCAGTCAACAAAATTCCGTTCCCGTGAATAACTCGACTAACACAACTCCAGCTCGCAGCTCGTGTCCCGGCCT
AAACGCGCTGGCAAACCACGGTTTCATCCCGCACAACGGTAAGGACCTGACCATGACGACCCTCATCGTCGGCTG
CTACGAGGGACTCGGAATCTCGCCCGAGACGTCAGCCCTCATCACGGCCGACGGCATGTCGGAAGCCGGCATTCC
CTTCGACACCGTCTTCAACCTGGAGCGCGTTCACTCGCAGCAATGGGGCATCGAGCACGACGTCAGCTTCGGCCG
CAATGACAGCGGTCACGGTGATCTTACTCTTCTTGACAAGGCCTCCTGGGACCTGACCCTTAAAGTTCTCGACGG
CTGCGGATATGGTGACGTTCCCTGCTGGGGCAAGGCCAAGGTGGCCCGCATCGAGCAGGAAAAGACGCGCTTCCC
GGGCTCAGACTACAGTAAGGAGGCCGCGGCCTATGGCGCCTCCGAGGTTGGCATGCTGTTTGGCGCCTTCGACCC
GGCCATCAAGAAGGACAACATGAAGAAGTGCGTCAAGTCGCTGTTCGAGGAGGAGAAGATTGAGATGGAGTGCAA
GCCGGACCGCATGGGAGCCGACTTCGAGGTCGTGACGGCAACCGGCGTCGCCCTCCTTGCCAGCGACCCGGTTCT
GCAAAAGGGCAGCGATGGCATGGTCACCACCGCCCAGGTAAGCCACACTCATCATCCCTGTTATCGTCAAGACTC
TGACAACCGGTCCAGGACATCCTCGCCGCAACCGGAAAGGGCAAGATTGACCTCGAAAAGGTCGTCGAGGTCCTG
CGTGCTGCAGGCTTCACTGAGAAGAAGCCATACGAGAACATGGAGCGTCTCATCGCCGCCGACAAGAAGATCAAG
GCGAACAAGGACCAGAAGAACGGCGATCACAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail