Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03871
Gene name
Locationscaffold_04:202491..203106
Strand+
Gene length (bp)615
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 2.1E-20 13 70
PF13233 Complex1_LYR_2 Complex1_LYR-like 2.4E-05 15 75

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.339 0.2291 0.0227 0.0552 0.966 0.0317 0.0343 0.0389 0.0869 0.0101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6321
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7847
Ophiocordyceps australis map64 (Brazil) OphauB2|6461
Ophiocordyceps camponoti-floridani Ophcf2|03871 (this protein)
Ophiocordyceps kimflemingae Ophio5|1637
Ophiocordyceps subramaniannii Hirsu2|9769

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03871
MSASSPMKGEMPQQVISLYRQLLRQAGQFKAYNFREYARRRTRDAYRDNRGVQDERKIQELVQKGLRELQVMKRQ
TYISRFYQLDRLVVEGGLSGRDNGKEGAVVRQKDQGWD*
Coding >Ophcf2|03871
ATGTCTGCCTCGAGCCCGATGAAAGGCGAGATGCCACAACAGGTTATATCTCTGTACCGCCAATTACTGCGGCAA
GCAGGGCAATTCAAGGCCTACAACTTCCGCGAGTACGCCAGACGACGGACGAGAGATGCCTACCGCGACAACCGG
GGCGTACAGGACGAGCGGAAGATACAGGAGCTGGTACAGAAGGGTTTGCGCGAGCTGCAGGTCATGAAGCGGCAG
ACGTACATCAGTCGGTTCTACCAGCTGGATCGGCTGGTCGTCGAGGGTGGCTTATCGGGACGGGATAACGGCAAA
GAGGGGGCTGTGGTGAGGCAAAAGGATCAAGGTTGGGACTGA
Transcript >Ophcf2|03871
ATGTCTGCCTCGAGCCCGATGAAAGGCGAGATGCCACAACAGGTTATATCTCTGTACCGCCAATTACTGCGGCAA
GCAGGGCAATTCAAGGCCTACAACTTCCGCGAGTACGCCAGACGACGGACGAGAGATGCCTACCGCGACAACCGG
GGCGTACAGGACGAGCGGAAGATACAGGAGCTGGTACAGAAGGGTTTGCGCGAGCTGCAGGTCATGAAGCGGCAG
ACGTACATCAGTCGGTTCTACCAGCTGGATCGGCTGGTCGTCGAGGGTGGCTTATCGGGACGGGATAACGGCAAA
GAGGGGGCTGTGGTGAGGCAAAAGGATCAAGGTTGGGACTGA
Gene >Ophcf2|03871
ATGTCTGCCTCGAGCCCGATGAAAGGCGAGATGCCACAACAGGTTATATCTCTGGTAAGAATCCCTGACGATGAG
ATCCCAGTCTCTTTCCTCCCTATCAGCCCTGATTCTGCTGGCTGGCATGTTACGTCACCGTCTGACCAGACTCGT
TTCCGCGACAGTACCGCCAATTACTGCGGCAAGCAGGGCAATTCAAGGCCTACAACTTCCGCGAGTACGCCAGAC
GACGGACGAGAGATGCCTACCGCGACAACCGGGGCGTACAGGACGAGCGGAAGATACAGGAGCTGGTACAGAAGG
GTTTGCGCGAGCTGCAGGTCATGAAGGTAGGGCGGAGGGCGGCATCTTCGGATCGTGACGGTCCCGCGTGCTGAC
GCTCGAGGCTGCAGCGGCAGACGTACATCAGTCGGTTCTACCAGCTGGATCGGCTGGTCGTCGAGGGTGGCTTAT
CGGTATGGTTTGGATGAAGACGCAAGGTTGACGAGTGACTGACTTGGCACAGGGACGGGATAACGGCAAAGAGGG
GGCTGTGGTGAGGCAAAAGGATCAAGGGTGAGTCTTGTTTCGGTCCTGGATCAAGAGATGGCTTCTGACTATCTG
AGAAGTTGGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail