Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03867
Gene name
Locationscaffold_04:192367..194217
Strand+
Gene length (bp)1850
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 5.0E-22 118 264

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1811 0.0599 0.8673 0.1195 0.094 0.0565 0.4376 0.5514 0.2764 0.0092

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999793

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 1.6E-48 117 306

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7793
Ophiocordyceps australis map64 (Brazil) OphauB2|5097
Ophiocordyceps camponoti-floridani Ophcf2|00778
Ophiocordyceps camponoti-floridani Ophcf2|03867 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5948
Ophiocordyceps camponoti-rufipedis Ophun1|6363
Ophiocordyceps kimflemingae Ophio5|1641
Ophiocordyceps kimflemingae Ophio5|2605
Ophiocordyceps kimflemingae Ophio5|3904
Ophiocordyceps subramaniannii Hirsu2|10680
Ophiocordyceps subramaniannii Hirsu2|1755
Ophiocordyceps subramaniannii Hirsu2|6804
Ophiocordyceps subramaniannii Hirsu2|9391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03867
MAKHTLVLVLLYSLIGLVVGHHSPHCKAFPGDDDWPSQQAWHGLNVTVSGRLLAPSPPGAVCHRDRATYDAEQCP
RVQKAWTTFEFHARDPVSVLWNQWTGFDCLPDPSRTCTGRGYPAYVVDALGTEDVKKAVDFARKHNVRLVVKNTG
YDFLGRSTAPAALSIRTINMKTIRLHEKGCFKLSSGRVFGETAVTVGAGTLTIDIYRALDEHGQTFIGAMGPTVG
IAGYLSGGGHSNLSGRYGLGADTVIEMEVVTPGGEVLTVNEHRHSHLFWALRGGGGSTFGVVTKITMRTFPTPKV
LGVQWVAGIDASEAQASNLAPALMSKLPEAIDAGLLGWNAVADKMHNPVPAPEALKGNISGLWGVNAVLDTASPS
EAHRILKPLSDTLQRPEWKGKARLWLKTRPFPSYLAYVTGVYTPRPGGYGWWEVSRMLDREALSGDAEALANALR
AVRSDRGNMFAMTLAGKGVQDVRPAGGDNSVNPAWRSAYALGMTSLTFKDERVSEGIRDFLNTAWQPMRDLTPES
GSYIDEASIISSLYSSRYDT*
Coding >Ophcf2|03867
ATGGCGAAGCACACCCTCGTCCTCGTCCTTCTCTACAGCCTGATAGGCCTCGTCGTCGGCCACCACTCACCACAC
TGCAAGGCCTTCCCAGGGGATGACGACTGGCCTTCACAGCAGGCATGGCACGGCCTCAACGTCACGGTTTCGGGC
CGCCTGCTGGCTCCGTCTCCCCCGGGCGCCGTCTGTCACCGCGACAGAGCGACGTACGACGCCGAGCAGTGCCCG
CGGGTGCAGAAGGCTTGGACGACGTTCGAGTTTCACGCGCGGGATCCCGTGTCGGTGCTGTGGAATCAGTGGACG
GGCTTCGACTGCCTGCCTGATCCGAGCAGGACTTGCACTGGAAGGGGGTATCCGGCGTATGTGGTAGATGCGTTG
GGGACCGAGGACGTCAAGAAGGCCGTCGACTTTGCTCGCAAGCACAACGTCAGACTCGTCGTCAAAAACACGGGC
TACGATTTCCTCGGCCGCTCCACCGCCCCAGCCGCCCTCTCCATCCGAACCATCAACATGAAGACCATCCGCCTC
CACGAGAAAGGCTGCTTCAAGCTCAGCAGCGGACGCGTCTTCGGCGAAACAGCCGTGACCGTCGGGGCCGGAACC
CTCACCATTGACATCTACCGCGCTCTCGACGAGCACGGCCAGACTTTCATCGGCGCCATGGGTCCTACCGTCGGT
ATCGCCGGTTATCTCTCGGGAGGAGGCCACTCGAATCTCTCGGGTCGGTATGGGCTCGGGGCCGATACCGTCATT
GAGATGGAGGTCGTCACGCCTGGAGGGGAGGTTCTGACCGTCAACGAGCATCGGCACAGTCATTTGTTCTGGGCC
TTGCGCGGTGGCGGAGGCTCGACCTTTGGAGTCGTCACAAAGATCACCATGCGCACTTTTCCCACCCCTAAAGTC
CTCGGCGTCCAGTGGGTAGCCGGCATCGACGCCTCGGAAGCCCAAGCCTCGAACCTCGCCCCGGCCCTCATGTCC
AAGCTCCCCGAAGCCATCGACGCCGGCCTCCTGGGCTGGAACGCGGTAGCCGACAAGATGCACAACCCAGTGCCC
GCCCCGGAAGCCCTCAAGGGAAACATCAGCGGCCTCTGGGGCGTCAACGCCGTCCTGGACACCGCCTCCCCCTCC
GAAGCCCACCGCATCCTCAAGCCCCTATCCGACACCCTCCAACGGCCCGAATGGAAGGGGAAAGCCCGTCTCTGG
CTGAAGACGAGGCCCTTCCCTTCCTACCTCGCCTACGTCACGGGCGTCTACACCCCGAGACCCGGCGGCTACGGC
TGGTGGGAGGTCTCTCGCATGCTGGATCGCGAGGCGCTCAGCGGCGACGCCGAAGCTCTCGCCAACGCCTTGCGG
GCCGTCCGCAGTGACAGGGGGAACATGTTCGCCATGACGCTGGCGGGTAAGGGCGTGCAGGACGTCAGGCCTGCC
GGGGGCGACAACTCGGTCAACCCGGCCTGGCGCAGCGCCTACGCCCTGGGCATGACGTCCCTGACCTTTAAAGAC
GAAAGGGTCTCCGAGGGAATACGCGATTTCCTCAACACGGCCTGGCAACCAATGCGGGATCTAACCCCCGAGTCG
GGCTCCTACATCGACGAGGCGAGCATCATTTCCTCCCTATACTCGTCCAGATATGATACATGA
Transcript >Ophcf2|03867
ATGGCGAAGCACACCCTCGTCCTCGTCCTTCTCTACAGCCTGATAGGCCTCGTCGTCGGCCACCACTCACCACAC
TGCAAGGCCTTCCCAGGGGATGACGACTGGCCTTCACAGCAGGCATGGCACGGCCTCAACGTCACGGTTTCGGGC
CGCCTGCTGGCTCCGTCTCCCCCGGGCGCCGTCTGTCACCGCGACAGAGCGACGTACGACGCCGAGCAGTGCCCG
CGGGTGCAGAAGGCTTGGACGACGTTCGAGTTTCACGCGCGGGATCCCGTGTCGGTGCTGTGGAATCAGTGGACG
GGCTTCGACTGCCTGCCTGATCCGAGCAGGACTTGCACTGGAAGGGGGTATCCGGCGTATGTGGTAGATGCGTTG
GGGACCGAGGACGTCAAGAAGGCCGTCGACTTTGCTCGCAAGCACAACGTCAGACTCGTCGTCAAAAACACGGGC
TACGATTTCCTCGGCCGCTCCACCGCCCCAGCCGCCCTCTCCATCCGAACCATCAACATGAAGACCATCCGCCTC
CACGAGAAAGGCTGCTTCAAGCTCAGCAGCGGACGCGTCTTCGGCGAAACAGCCGTGACCGTCGGGGCCGGAACC
CTCACCATTGACATCTACCGCGCTCTCGACGAGCACGGCCAGACTTTCATCGGCGCCATGGGTCCTACCGTCGGT
ATCGCCGGTTATCTCTCGGGAGGAGGCCACTCGAATCTCTCGGGTCGGTATGGGCTCGGGGCCGATACCGTCATT
GAGATGGAGGTCGTCACGCCTGGAGGGGAGGTTCTGACCGTCAACGAGCATCGGCACAGTCATTTGTTCTGGGCC
TTGCGCGGTGGCGGAGGCTCGACCTTTGGAGTCGTCACAAAGATCACCATGCGCACTTTTCCCACCCCTAAAGTC
CTCGGCGTCCAGTGGGTAGCCGGCATCGACGCCTCGGAAGCCCAAGCCTCGAACCTCGCCCCGGCCCTCATGTCC
AAGCTCCCCGAAGCCATCGACGCCGGCCTCCTGGGCTGGAACGCGGTAGCCGACAAGATGCACAACCCAGTGCCC
GCCCCGGAAGCCCTCAAGGGAAACATCAGCGGCCTCTGGGGCGTCAACGCCGTCCTGGACACCGCCTCCCCCTCC
GAAGCCCACCGCATCCTCAAGCCCCTATCCGACACCCTCCAACGGCCCGAATGGAAGGGGAAAGCCCGTCTCTGG
CTGAAGACGAGGCCCTTCCCTTCCTACCTCGCCTACGTCACGGGCGTCTACACCCCGAGACCCGGCGGCTACGGC
TGGTGGGAGGTCTCTCGCATGCTGGATCGCGAGGCGCTCAGCGGCGACGCCGAAGCTCTCGCCAACGCCTTGCGG
GCCGTCCGCAGTGACAGGGGGAACATGTTCGCCATGACGCTGGCGGGTAAGGGCGTGCAGGACGTCAGGCCTGCC
GGGGGCGACAACTCGGTCAACCCGGCCTGGCGCAGCGCCTACGCCCTGGGCATGACGTCCCTGACCTTTAAAGAC
GAAAGGGTCTCCGAGGGAATACGCGATTTCCTCAACACGGCCTGGCAACCAATGCGGGATCTAACCCCCGAGTCG
GGCTCCTACATCGACGAGGCGAGCATCATTTCCTCCCTATACTCGTCCAGATATGATACATGA
Gene >Ophcf2|03867
ATGGCGAAGCACACCCTCGTCCTCGTCCTTCTCTACAGCCTGATAGGCCTCGTCGTCGGCCACCACTCACCACAC
TGCAAGGCCTTCCCAGGGGATGACGACTGGCCTTCACAGCAGGCATGGCACGGCCTCAACGTCACGGTTTCGGGC
CGCCTGCTGGCTCCGTCTCCCCCGGGCGCCGTCTGTCACCGCGACAGAGCGACGTACGACGCCGAGCAGTGCCCG
CGGGTGCAGAAGGCTTGGACGACGTTCGAGTTTCACGCGCGGGATCCCGTGTCGGTGCTGTGGAATCAGTGGACG
GGCTTCGACTGCCTGCCTGATCCGAGCAGGACTTGCACTGGAAGGGGGTATCCGGCGTATGTGGTAGATGCGTTG
GGGACCGAGGACGTCAAGAAGGCCGTCGACTTTGGTATGTGTCCATCCCTTGGATGTTTACCTTTTTTCCATCTC
CGTCTGAATAGCATCATAAGCTCGCAAGCACAACGTCAGACTCGTCGTCAAAAACACGGGCTACGATTTCCTCGG
CCGCTCCACCGCCCCAGCCGCCCTCTCCATCCGAACCATCAACATGAAGACCATCCGCCTCCACGAGAAAGGCTG
CTTCAAGCTCAGCAGCGGACGCGTCTTCGGCGAAACAGCCGTGACCGTCGGGGCCGGAACCCTCACCATTGACAT
CTACCGCGCTCTCGACGAGCACGGCCAGACTTTCATCGGCGCCATGGGTCCTACCGTCGGTATCGCCGGTTATCT
CTCGGGAGGAGGCCACTCGAATCTCTCGGGTCGGTATGGGCTCGGGGCCGATACCGTCATTGAGATGGAGGTCGT
CACGCCTGGAGGGGAGGTTCTGACCGTCAACGAGCATCGGCACAGTCATTTGTTCTGGGCCTTGCGCGGTGTAAG
TCCAAATCCCCCCCCAACTTGAACCCCCAGCCAGGCAACTAACAACGAGACCGATGATACTTGCTCCCTGAAATC
TCAGGGCGGAGGCTCGACCTTTGGAGTCGTCACAAAGATCACCATGCGCACTTTTCCCACCCCTAAAGTCCTCGG
CGTCCAGTGGGTAGCCGGCATCGACGCCTCGGAAGCCCAAGCCTCGAACCTCGCCCCGGCCCTCATGTCCAAGCT
CCCCGAAGCCATCGACGCCGGCCTCCTGGGCTGGAACGCGGTAGCCGACAAGATGCACAACCCAGTGCCCGCCCC
GGAAGCCCTCAAGGGAAACATCAGCGGCCTCTGGGGCGTCAACGCCGTCCTGGACACCGCCTCCCCCTCCGAAGC
CCACCGCATCCTCAAGCCCCTATCCGACACCCTCCAACGGCCCGAATGGAAGGGGAAAGCCCGTCTCTGGCTGAA
GACGAGGCCCTTCCCTTCCTACCTCGCCTACGTCACGGGCGTCTACACCCCGAGACCCGGCGGCTACGGCTGGTG
GGAGGTCTCTCGCATGCTGGATCGCGAGGCGCTCAGCGGCGACGCCGAAGCTCTCGCCAACGCCTTGCGGGCCGT
CCGCAGTGACAGGGGGAACATGTTCGCCATGACGCTGGCGGGTAAGGGCGTGCAGGACGTCAGGCCTGCCGGGGG
CGACAACTCGGTCAACCCGGCCTGGCGCAGCGCCTACGCCCTGGGCAGTGCGTGAAACGATGGGCGGTCATGGGG
GGAAGCTGTGAATTCAAGTCCTTTGCTGACGAGCTTCAGTGACGTCCCTGACCTTTAAAGACGAAAGGGTCTCCG
AGGGAATACGCGATTTCCTCAACACGGCCTGGCAACCAATGCGGGATCTAACCCCCGAGTCGGGCTCCTACATCG
ACGAGGCGAGCATCATTTCCTCCCTATACTCGTCCAGATATGATACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail