Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03864
Gene name
Locationscaffold_04:185153..187279
Strand-
Gene length (bp)2126
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06772 LtrA Bacterial low temperature requirement A protein (LtrA) 8.4E-18 48 330

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 80 97 17
2 110 129 19
3 139 161 22
4 173 195 22
5 205 227 22
6 239 261 22
7 271 293 22
8 313 332 19
9 486 508 22
10 517 539 22
11 554 576 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.00 0.0 0.00
Alive In ants, during behavior modification 0.01 0.0 0.08
Dead In ants, recently dead 0.02 0.0 0.09

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03864
MEEGFELSPVSVDKLRLFNSPITETDEKRDENGFEEELPRFQEREEPTLLEVFFDLVFAANYNVFTDNQEVTDTA
RFKAYLGYFFLLWLTWLLVTLFDVRYVTDSIFTRLTRAIQLGVLVGFTIVAPTFNPTSQHQETMRAMSIILMVSR
ACLAVEYGAVLHHVKDYKAARLPVILQICVHFSAAIIYLGLTFSFRGDVKSQDFIVWYFISAAEAMLTVLLSNLY
SVLSFTKTHLIKRLTLLTVIIVGDGIIQVAREVVTIVKNPDAWDGVTIGLVTAAVATIYFVFLVYFDWLRDSFHL
PAIRQQLWMSVHLPFHLSLILFTQGFTQFLIWSKIVDVLNTVSMGFGRKGHEWLAEATSAEVQTRLNESTQAFFL
DFPPKIPSTWITINDAISNITLIPDAFWSELSSYYETHNASVFNATDLRAAQVFSDIMTASMSSMANALFATFGM
DLESDVTNKNPRLYDDIRGGGFQGEVQTETWDRYRLVFACTYLAAASTLLFMIALAILARTTPFKTWPIIRLAII
SGLALGTGMTSILFFNHDRVFKFLLSPWVLPTIAFVWTVTIILTHINAGNVGRRIRRFARRSIGPALPSITIVAA
DGGWHKMRGGEV*
Coding >Ophcf2|03864
ATGGAGGAGGGATTCGAGCTGAGCCCGGTCTCTGTCGACAAGCTGCGGCTATTCAACAGTCCCATAACCGAGACG
GATGAGAAGCGCGACGAGAATGGATTCGAGGAGGAGTTGCCTCGTTTTCAGGAGCGCGAGGAGCCGACTTTGCTC
GAGGTCTTCTTCGATCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCGACACTGCC
AGGTTCAAGGCCTACCTTGGATACTTCTTTCTTCTCTGGTTGACGTGGCTCCTCGTCACCCTCTTCGATGTCCGA
TACGTTACGGACAGCATCTTCACCCGTCTGACGAGAGCCATCCAGCTCGGCGTCCTCGTCGGCTTCACCATCGTC
GCGCCCACCTTTAACCCAACCAGTCAGCACCAAGAGACGATGCGAGCCATGTCCATCATCCTCATGGTCTCACGC
GCGTGCTTGGCTGTCGAGTACGGGGCTGTTCTTCACCACGTCAAAGACTACAAGGCTGCTCGCCTCCCCGTCATC
CTGCAGATATGCGTCCACTTCTCAGCGGCCATCATCTACCTCGGCCTCACGTTTAGTTTCCGCGGCGACGTCAAG
AGCCAGGACTTTATCGTGTGGTACTTTATATCCGCGGCCGAGGCCATGTTGACCGTCCTGCTGTCGAACCTATAT
TCCGTCCTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTTACCGTCATCATCGTCGGTGACGGC
ATCATCCAGGTGGCGAGGGAAGTCGTCACTATTGTCAAGAACCCGGATGCCTGGGACGGCGTGACGATAGGGCTC
GTTACGGCTGCCGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTTGACTGGCTGAGAGACTCGTTCCATCTG
CCAGCCATCCGTCAGCAGCTGTGGATGAGCGTTCACCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGC
TTCACGCAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACGGTGAGCATGGGCTTCGGCCGTAAGGGA
CATGAGTGGCTCGCGGAAGCCACCAGCGCAGAGGTTCAAACCAGACTCAACGAGAGCACGCAGGCCTTCTTCTTA
GACTTCCCGCCCAAGATCCCCAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCCGAC
GCCTTTTGGTCCGAGCTCTCCAGCTACTATGAGACGCACAATGCCTCCGTCTTCAACGCTACCGACCTCAGGGCC
GCTCAGGTCTTTTCCGACATCATGACGGCCTCCATGTCGTCCATGGCCAACGCCCTCTTTGCTACCTTTGGCATG
GATCTGGAAAGCGACGTGACGAACAAGAACCCCCGGCTGTACGATGATATCAGGGGTGGTGGCTTCCAGGGAGAG
GTTCAGACTGAGACGTGGGATCGATACCGGCTTGTGTTTGCCTGCACCTATCTCGCCGCTGCCTCTACCCTCTTG
TTCATGATCGCCCTCGCCATCTTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTCGCCATCATC
TCCGGTCTCGCTCTCGGCACAGGCATGACCTCGATCCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTC
TCGCCTTGGGTGCTGCCCACCATCGCCTTCGTATGGACCGTCACCATCATCCTCACTCACATCAATGCGGGCAAC
GTCGGACGTCGTATCCGCCGGTTTGCTCGTCGTAGCATTGGCCCGGCTTTGCCCAGCATTACTATCGTCGCAGCT
GACGGGGGATGGCACAAGATGAGAGGTGGTGAAGTGTGA
Transcript >Ophcf2|03864
ATGGAGGAGGGATTCGAGCTGAGCCCGGTCTCTGTCGACAAGCTGCGGCTATTCAACAGTCCCATAACCGAGACG
GATGAGAAGCGCGACGAGAATGGATTCGAGGAGGAGTTGCCTCGTTTTCAGGAGCGCGAGGAGCCGACTTTGCTC
GAGGTCTTCTTCGATCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCGACACTGCC
AGGTTCAAGGCCTACCTTGGATACTTCTTTCTTCTCTGGTTGACGTGGCTCCTCGTCACCCTCTTCGATGTCCGA
TACGTTACGGACAGCATCTTCACCCGTCTGACGAGAGCCATCCAGCTCGGCGTCCTCGTCGGCTTCACCATCGTC
GCGCCCACCTTTAACCCAACCAGTCAGCACCAAGAGACGATGCGAGCCATGTCCATCATCCTCATGGTCTCACGC
GCGTGCTTGGCTGTCGAGTACGGGGCTGTTCTTCACCACGTCAAAGACTACAAGGCTGCTCGCCTCCCCGTCATC
CTGCAGATATGCGTCCACTTCTCAGCGGCCATCATCTACCTCGGCCTCACGTTTAGTTTCCGCGGCGACGTCAAG
AGCCAGGACTTTATCGTGTGGTACTTTATATCCGCGGCCGAGGCCATGTTGACCGTCCTGCTGTCGAACCTATAT
TCCGTCCTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTTACCGTCATCATCGTCGGTGACGGC
ATCATCCAGGTGGCGAGGGAAGTCGTCACTATTGTCAAGAACCCGGATGCCTGGGACGGCGTGACGATAGGGCTC
GTTACGGCTGCCGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTTGACTGGCTGAGAGACTCGTTCCATCTG
CCAGCCATCCGTCAGCAGCTGTGGATGAGCGTTCACCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGC
TTCACGCAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACGGTGAGCATGGGCTTCGGCCGTAAGGGA
CATGAGTGGCTCGCGGAAGCCACCAGCGCAGAGGTTCAAACCAGACTCAACGAGAGCACGCAGGCCTTCTTCTTA
GACTTCCCGCCCAAGATCCCCAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCCGAC
GCCTTTTGGTCCGAGCTCTCCAGCTACTATGAGACGCACAATGCCTCCGTCTTCAACGCTACCGACCTCAGGGCC
GCTCAGGTCTTTTCCGACATCATGACGGCCTCCATGTCGTCCATGGCCAACGCCCTCTTTGCTACCTTTGGCATG
GATCTGGAAAGCGACGTGACGAACAAGAACCCCCGGCTGTACGATGATATCAGGGGTGGTGGCTTCCAGGGAGAG
GTTCAGACTGAGACGTGGGATCGATACCGGCTTGTGTTTGCCTGCACCTATCTCGCCGCTGCCTCTACCCTCTTG
TTCATGATCGCCCTCGCCATCTTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTCGCCATCATC
TCCGGTCTCGCTCTCGGCACAGGCATGACCTCGATCCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTC
TCGCCTTGGGTGCTGCCCACCATCGCCTTCGTATGGACCGTCACCATCATCCTCACTCACATCAATGCGGGCAAC
GTCGGACGTCGTATCCGCCGGTTTGCTCGTCGTAGCATTGGCCCGGCTTTGCCCAGCATTACTATCGTCGCAGCT
GACGGGGGATGGCACAAGATGAGAGGTGGTGAAGTGTGA
Gene >Ophcf2|03864
ATGGAGGAGGGATTCGAGCTGAGCCCGGTCTCTGTCGACAAGCTGCGGCTATTCAACAGTCCCATAACCGAGACG
GATGAGAAGCGCGACGAGAATGGATTCGAGGAGGAGTTGCCTCGTTTTCAGGAGGTTCGTGACTGCGAGAAGCCG
GGGCTGAATGCGAGTGATGCTGATGGTTTATACAATGTAGCGCGAGGAGCCGACTTTGCTCGAGGTCTTCTTCGA
TCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCGACACTGCCAGGTTCAAGGCCTA
CCTTGGATACTTCTTGTAAGTGGACGTCCGATGGCTGGAAGAGGCTACATGTTCTGACGCCGTCATGACAGTCTT
CTCTGGTTGACGTGGCTCCTCGTCACCCTCTTCGATGTCCGATACGTTACGGACAGCATCTTCAGTAGGCGTCTC
GCACTCGAAACGACTCCCGGCTGCTGACTCTCAACAGCCCGTCTGACGAGAGCCATCCAGCTCGGCGTCCTCGTC
GGCTTCACCATCGTCGCGCCCACCTTTAACCCAACCAGTCAGCACCAAGAGACGATGCGAGCCATGTGTAAGCCC
GCTTGCAACTCGCCAGACGAGACGACATGTACGCTAACTACAGCAGCCATCATCCTCATGGTCTCACGCGCGTGC
TTGGCTGTCGAGTACGGGGCTGTTCTTCACCACGTCAAAGACTACAAGGCTGCTCGCCTCCCCGTCATCCTGCAG
ATATGCGTCCACTTCTCAGCGGCCATCATCTACCTCGGCCTCACGTTTAGTTTCCGCGGCGACGTCAAGAGCCAG
GACTTTATCGTGTGGTACTTTATATCCGCGGCCGAGGCCATGTTGACCGTCCTGCTGTCGAACCTATATTCCGTC
CTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTTACCGTCATCATCGTCGGTGACGGCATCATC
CAGGTGGCGAGGGAAGTCGTCACTATTGTCAAGAACCCGGATGCCTGGGACGGCGTGACGATAGGGCTCGTTACG
GCTGCCGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTTGACTGGCTGAGAGACTCGTTCCATCTGCCAGCC
ATCCGTCAGCAGCTGTGGATGAGCGTTCACCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGCTTCACG
CAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACGGTGAGCATGGGCTTCGGCCGTAAGGGACATGAG
TGGCTCGCGGAAGCCACCAGCGCAGAGGTTCAAACCAGACTCAACGAGAGCACGCAGGCCTTCTTCTTAGACTTC
CCGCCCAAGATCCCCAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCCGACGCCTTT
TGGTCCGAGCTCTCCAGCTACTATGAGACGCACAATGCCTCCGTCTTCAACGCTACCGACCTCAGGGCCGCTCAG
GTCTTTTCCGACATCATGACGGCCTCCATGTCGTCCATGGCCAACGCCCTCTTTGCTACCTTTGGCATGGATCTG
GAAAGCGACGTGACGAACAAGAACCCCCGGCTGTACGATGATATCAGGGGTGGTGGCTTCCAGGGAGAGGTTCAG
ACTGAGACGTGGGATCGATACCGGCTTGTGGTGGGTTGTCCACGCTCCATCTGTACAAGCAGCAGTTGAACAAGG
TTGCTGATGCTCATTGATGTCAGTTTGCCTGCACCTATCTCGCCGCTGCCTCTACCCTCTTGTTCATGATCGCCC
TCGCCATCTTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTCGCCATCATCTCCGGTCTCGCTC
TCGGCACAGGCATGACCTCGATCCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTCTCGCCTTGGGTGC
TGCCCACCATCGCCTTCGTATGGACCGTCACCATCATCCTCACTCACATCAATGCGGGCAACGTCGGACGTCGTA
TCCGCCGGTTTGCTCGTCGTAGCATTGGCCCGGCTTTGCCCAGCATTACTATCGTCGCAGCTGACGGGGGATGGC
ACAAGATGAGAGGTGGTGAAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail