Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03864
Gene name
Locationscaffold_04:185153..187279
Strand-
Gene length (bp)2126
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06772 LtrA Bacterial low temperature requirement A protein (LtrA) 8.4E-18 48 330

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 80 97 17
2 110 129 19
3 139 161 22
4 173 195 22
5 205 227 22
6 239 261 22
7 271 293 22
8 313 332 19
9 486 508 22
10 517 539 22
11 554 576 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03864
MEEGFELSPVSVDKLRLFNSPITETDEKRDENGFEEELPRFQEREEPTLLEVFFDLVFAANYNVFTDNQEVTDTA
RFKAYLGYFFLLWLTWLLVTLFDVRYVTDSIFTRLTRAIQLGVLVGFTIVAPTFNPTSQHQETMRAMSIILMVSR
ACLAVEYGAVLHHVKDYKAARLPVILQICVHFSAAIIYLGLTFSFRGDVKSQDFIVWYFISAAEAMLTVLLSNLY
SVLSFTKTHLIKRLTLLTVIIVGDGIIQVAREVVTIVKNPDAWDGVTIGLVTAAVATIYFVFLVYFDWLRDSFHL
PAIRQQLWMSVHLPFHLSLILFTQGFTQFLIWSKIVDVLNTVSMGFGRKGHEWLAEATSAEVQTRLNESTQAFFL
DFPPKIPSTWITINDAISNITLIPDAFWSELSSYYETHNASVFNATDLRAAQVFSDIMTASMSSMANALFATFGM
DLESDVTNKNPRLYDDIRGGGFQGEVQTETWDRYRLVFACTYLAAASTLLFMIALAILARTTPFKTWPIIRLAII
SGLALGTGMTSILFFNHDRVFKFLLSPWVLPTIAFVWTVTIILTHINAGNVGRRIRRFARRSIGPALPSITIVAA
DGGWHKMRGGEV*
Coding >Ophcf2|03864
ATGGAGGAGGGATTCGAGCTGAGCCCGGTCTCTGTCGACAAGCTGCGGCTATTCAACAGTCCCATAACCGAGACG
GATGAGAAGCGCGACGAGAATGGATTCGAGGAGGAGTTGCCTCGTTTTCAGGAGCGCGAGGAGCCGACTTTGCTC
GAGGTCTTCTTCGATCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCGACACTGCC
AGGTTCAAGGCCTACCTTGGATACTTCTTTCTTCTCTGGTTGACGTGGCTCCTCGTCACCCTCTTCGATGTCCGA
TACGTTACGGACAGCATCTTCACCCGTCTGACGAGAGCCATCCAGCTCGGCGTCCTCGTCGGCTTCACCATCGTC
GCGCCCACCTTTAACCCAACCAGTCAGCACCAAGAGACGATGCGAGCCATGTCCATCATCCTCATGGTCTCACGC
GCGTGCTTGGCTGTCGAGTACGGGGCTGTTCTTCACCACGTCAAAGACTACAAGGCTGCTCGCCTCCCCGTCATC
CTGCAGATATGCGTCCACTTCTCAGCGGCCATCATCTACCTCGGCCTCACGTTTAGTTTCCGCGGCGACGTCAAG
AGCCAGGACTTTATCGTGTGGTACTTTATATCCGCGGCCGAGGCCATGTTGACCGTCCTGCTGTCGAACCTATAT
TCCGTCCTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTTACCGTCATCATCGTCGGTGACGGC
ATCATCCAGGTGGCGAGGGAAGTCGTCACTATTGTCAAGAACCCGGATGCCTGGGACGGCGTGACGATAGGGCTC
GTTACGGCTGCCGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTTGACTGGCTGAGAGACTCGTTCCATCTG
CCAGCCATCCGTCAGCAGCTGTGGATGAGCGTTCACCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGC
TTCACGCAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACGGTGAGCATGGGCTTCGGCCGTAAGGGA
CATGAGTGGCTCGCGGAAGCCACCAGCGCAGAGGTTCAAACCAGACTCAACGAGAGCACGCAGGCCTTCTTCTTA
GACTTCCCGCCCAAGATCCCCAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCCGAC
GCCTTTTGGTCCGAGCTCTCCAGCTACTATGAGACGCACAATGCCTCCGTCTTCAACGCTACCGACCTCAGGGCC
GCTCAGGTCTTTTCCGACATCATGACGGCCTCCATGTCGTCCATGGCCAACGCCCTCTTTGCTACCTTTGGCATG
GATCTGGAAAGCGACGTGACGAACAAGAACCCCCGGCTGTACGATGATATCAGGGGTGGTGGCTTCCAGGGAGAG
GTTCAGACTGAGACGTGGGATCGATACCGGCTTGTGTTTGCCTGCACCTATCTCGCCGCTGCCTCTACCCTCTTG
TTCATGATCGCCCTCGCCATCTTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTCGCCATCATC
TCCGGTCTCGCTCTCGGCACAGGCATGACCTCGATCCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTC
TCGCCTTGGGTGCTGCCCACCATCGCCTTCGTATGGACCGTCACCATCATCCTCACTCACATCAATGCGGGCAAC
GTCGGACGTCGTATCCGCCGGTTTGCTCGTCGTAGCATTGGCCCGGCTTTGCCCAGCATTACTATCGTCGCAGCT
GACGGGGGATGGCACAAGATGAGAGGTGGTGAAGTGTGA
Transcript >Ophcf2|03864
ATGGAGGAGGGATTCGAGCTGAGCCCGGTCTCTGTCGACAAGCTGCGGCTATTCAACAGTCCCATAACCGAGACG
GATGAGAAGCGCGACGAGAATGGATTCGAGGAGGAGTTGCCTCGTTTTCAGGAGCGCGAGGAGCCGACTTTGCTC
GAGGTCTTCTTCGATCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCGACACTGCC
AGGTTCAAGGCCTACCTTGGATACTTCTTTCTTCTCTGGTTGACGTGGCTCCTCGTCACCCTCTTCGATGTCCGA
TACGTTACGGACAGCATCTTCACCCGTCTGACGAGAGCCATCCAGCTCGGCGTCCTCGTCGGCTTCACCATCGTC
GCGCCCACCTTTAACCCAACCAGTCAGCACCAAGAGACGATGCGAGCCATGTCCATCATCCTCATGGTCTCACGC
GCGTGCTTGGCTGTCGAGTACGGGGCTGTTCTTCACCACGTCAAAGACTACAAGGCTGCTCGCCTCCCCGTCATC
CTGCAGATATGCGTCCACTTCTCAGCGGCCATCATCTACCTCGGCCTCACGTTTAGTTTCCGCGGCGACGTCAAG
AGCCAGGACTTTATCGTGTGGTACTTTATATCCGCGGCCGAGGCCATGTTGACCGTCCTGCTGTCGAACCTATAT
TCCGTCCTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTTACCGTCATCATCGTCGGTGACGGC
ATCATCCAGGTGGCGAGGGAAGTCGTCACTATTGTCAAGAACCCGGATGCCTGGGACGGCGTGACGATAGGGCTC
GTTACGGCTGCCGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTTGACTGGCTGAGAGACTCGTTCCATCTG
CCAGCCATCCGTCAGCAGCTGTGGATGAGCGTTCACCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGC
TTCACGCAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACGGTGAGCATGGGCTTCGGCCGTAAGGGA
CATGAGTGGCTCGCGGAAGCCACCAGCGCAGAGGTTCAAACCAGACTCAACGAGAGCACGCAGGCCTTCTTCTTA
GACTTCCCGCCCAAGATCCCCAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCCGAC
GCCTTTTGGTCCGAGCTCTCCAGCTACTATGAGACGCACAATGCCTCCGTCTTCAACGCTACCGACCTCAGGGCC
GCTCAGGTCTTTTCCGACATCATGACGGCCTCCATGTCGTCCATGGCCAACGCCCTCTTTGCTACCTTTGGCATG
GATCTGGAAAGCGACGTGACGAACAAGAACCCCCGGCTGTACGATGATATCAGGGGTGGTGGCTTCCAGGGAGAG
GTTCAGACTGAGACGTGGGATCGATACCGGCTTGTGTTTGCCTGCACCTATCTCGCCGCTGCCTCTACCCTCTTG
TTCATGATCGCCCTCGCCATCTTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTCGCCATCATC
TCCGGTCTCGCTCTCGGCACAGGCATGACCTCGATCCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTC
TCGCCTTGGGTGCTGCCCACCATCGCCTTCGTATGGACCGTCACCATCATCCTCACTCACATCAATGCGGGCAAC
GTCGGACGTCGTATCCGCCGGTTTGCTCGTCGTAGCATTGGCCCGGCTTTGCCCAGCATTACTATCGTCGCAGCT
GACGGGGGATGGCACAAGATGAGAGGTGGTGAAGTGTGA
Gene >Ophcf2|03864
ATGGAGGAGGGATTCGAGCTGAGCCCGGTCTCTGTCGACAAGCTGCGGCTATTCAACAGTCCCATAACCGAGACG
GATGAGAAGCGCGACGAGAATGGATTCGAGGAGGAGTTGCCTCGTTTTCAGGAGGTTCGTGACTGCGAGAAGCCG
GGGCTGAATGCGAGTGATGCTGATGGTTTATACAATGTAGCGCGAGGAGCCGACTTTGCTCGAGGTCTTCTTCGA
TCTCGTCTTTGCCGCCAACTACAATGTCTTTACCGATAATCAGGAGGTTACCGACACTGCCAGGTTCAAGGCCTA
CCTTGGATACTTCTTGTAAGTGGACGTCCGATGGCTGGAAGAGGCTACATGTTCTGACGCCGTCATGACAGTCTT
CTCTGGTTGACGTGGCTCCTCGTCACCCTCTTCGATGTCCGATACGTTACGGACAGCATCTTCAGTAGGCGTCTC
GCACTCGAAACGACTCCCGGCTGCTGACTCTCAACAGCCCGTCTGACGAGAGCCATCCAGCTCGGCGTCCTCGTC
GGCTTCACCATCGTCGCGCCCACCTTTAACCCAACCAGTCAGCACCAAGAGACGATGCGAGCCATGTGTAAGCCC
GCTTGCAACTCGCCAGACGAGACGACATGTACGCTAACTACAGCAGCCATCATCCTCATGGTCTCACGCGCGTGC
TTGGCTGTCGAGTACGGGGCTGTTCTTCACCACGTCAAAGACTACAAGGCTGCTCGCCTCCCCGTCATCCTGCAG
ATATGCGTCCACTTCTCAGCGGCCATCATCTACCTCGGCCTCACGTTTAGTTTCCGCGGCGACGTCAAGAGCCAG
GACTTTATCGTGTGGTACTTTATATCCGCGGCCGAGGCCATGTTGACCGTCCTGCTGTCGAACCTATATTCCGTC
CTCAGCTTCACAAAGACCCATCTCATCAAGCGGCTCACGCTGCTTACCGTCATCATCGTCGGTGACGGCATCATC
CAGGTGGCGAGGGAAGTCGTCACTATTGTCAAGAACCCGGATGCCTGGGACGGCGTGACGATAGGGCTCGTTACG
GCTGCCGTGGCTACCATCTACTTCGTCTTCCTCGTCTACTTTGACTGGCTGAGAGACTCGTTCCATCTGCCAGCC
ATCCGTCAGCAGCTGTGGATGAGCGTTCACCTCCCCTTTCACCTCTCGCTCATTCTCTTCACCCAGGGCTTCACG
CAGTTCCTCATATGGTCAAAGATCGTCGACGTCCTCAACACGGTGAGCATGGGCTTCGGCCGTAAGGGACATGAG
TGGCTCGCGGAAGCCACCAGCGCAGAGGTTCAAACCAGACTCAACGAGAGCACGCAGGCCTTCTTCTTAGACTTC
CCGCCCAAGATCCCCAGCACTTGGATCACCATCAACGATGCCATATCCAACATCACCCTCATCCCCGACGCCTTT
TGGTCCGAGCTCTCCAGCTACTATGAGACGCACAATGCCTCCGTCTTCAACGCTACCGACCTCAGGGCCGCTCAG
GTCTTTTCCGACATCATGACGGCCTCCATGTCGTCCATGGCCAACGCCCTCTTTGCTACCTTTGGCATGGATCTG
GAAAGCGACGTGACGAACAAGAACCCCCGGCTGTACGATGATATCAGGGGTGGTGGCTTCCAGGGAGAGGTTCAG
ACTGAGACGTGGGATCGATACCGGCTTGTGGTGGGTTGTCCACGCTCCATCTGTACAAGCAGCAGTTGAACAAGG
TTGCTGATGCTCATTGATGTCAGTTTGCCTGCACCTATCTCGCCGCTGCCTCTACCCTCTTGTTCATGATCGCCC
TCGCCATCTTGGCACGAACGACGCCCTTCAAGACGTGGCCCATCATCCGTCTCGCCATCATCTCCGGTCTCGCTC
TCGGCACAGGCATGACCTCGATCCTCTTCTTCAACCACGATCGTGTCTTCAAGTTCCTGCTCTCGCCTTGGGTGC
TGCCCACCATCGCCTTCGTATGGACCGTCACCATCATCCTCACTCACATCAATGCGGGCAACGTCGGACGTCGTA
TCCGCCGGTTTGCTCGTCGTAGCATTGGCCCGGCTTTGCCCAGCATTACTATCGTCGCAGCTGACGGGGGATGGC
ACAAGATGAGAGGTGGTGAAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail