Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03861
Gene name
Locationscaffold_04:146218..146944
Strand+
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.00 0.00 0.00
Alive In ants, during behavior modification 10.23 2.39 18.07
Dead In ants, recently dead 3.90 0.45 7.35

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000851 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03861
MASSSLPFLNHDQDKAESDLDISDHELGARRKRRCHRREWRRLHSVGHVVVFLLASWGLIALCLEIAQRITSQQW
LFRSETPDPYHPETLEPGRNSCHCGNTIKEALSLGCVYDTMATAWLPPYCRDEKLTAEFDRSGPGPEGQWSYFAD
KAGTVPLSTAEMARLGETDGSFWASRDWHIVHCLFYWQKYIRMRETGVIMEQRFDTIHHVKHCSRLIRNPVPDHF
FLIEVPVRMNSSMDDE*
Coding >Ophcf2|03861
ATGGCATCATCTAGTCTTCCGTTTCTAAACCATGACCAGGACAAGGCGGAGAGCGATCTGGACATATCAGACCAT
GAGCTGGGAGCAAGACGGAAGCGTCGATGCCACAGGAGAGAATGGCGACGTCTTCACTCTGTCGGTCATGTCGTT
GTTTTCCTCCTCGCCAGCTGGGGCCTCATTGCCCTCTGTCTTGAGATTGCCCAACGCATCACAAGCCAGCAATGG
CTCTTCCGATCGGAAACCCCTGACCCTTATCATCCCGAGACCCTAGAACCAGGACGCAACAGCTGCCACTGCGGC
AACACCATCAAGGAGGCTCTCTCACTCGGCTGCGTCTACGACACCATGGCAACAGCCTGGCTCCCTCCATACTGC
CGCGACGAGAAGCTAACAGCCGAGTTCGACCGCTCCGGTCCCGGTCCGGAAGGGCAGTGGTCCTACTTCGCCGAT
AAGGCAGGGACGGTGCCGCTCAGCACAGCGGAGATGGCCCGTCTAGGAGAGACGGACGGGTCGTTTTGGGCGTCG
AGAGATTGGCATATTGTTCACTGTCTTTTCTACTGGCAGAAGTATATCCGGATGCGCGAGACGGGCGTCATCATG
GAGCAGAGGTTCGACACCATTCACCATGTGAAGCATTGCTCGCGCTTGATCAGGAATCCTGTTCCGGACCATTTC
TTTTTGATTGAGGTTCCTGTGCGGATGAATTCTAGTATGGATGATGAATAG
Transcript >Ophcf2|03861
ATGGCATCATCTAGTCTTCCGTTTCTAAACCATGACCAGGACAAGGCGGAGAGCGATCTGGACATATCAGACCAT
GAGCTGGGAGCAAGACGGAAGCGTCGATGCCACAGGAGAGAATGGCGACGTCTTCACTCTGTCGGTCATGTCGTT
GTTTTCCTCCTCGCCAGCTGGGGCCTCATTGCCCTCTGTCTTGAGATTGCCCAACGCATCACAAGCCAGCAATGG
CTCTTCCGATCGGAAACCCCTGACCCTTATCATCCCGAGACCCTAGAACCAGGACGCAACAGCTGCCACTGCGGC
AACACCATCAAGGAGGCTCTCTCACTCGGCTGCGTCTACGACACCATGGCAACAGCCTGGCTCCCTCCATACTGC
CGCGACGAGAAGCTAACAGCCGAGTTCGACCGCTCCGGTCCCGGTCCGGAAGGGCAGTGGTCCTACTTCGCCGAT
AAGGCAGGGACGGTGCCGCTCAGCACAGCGGAGATGGCCCGTCTAGGAGAGACGGACGGGTCGTTTTGGGCGTCG
AGAGATTGGCATATTGTTCACTGTCTTTTCTACTGGCAGAAGTATATCCGGATGCGCGAGACGGGCGTCATCATG
GAGCAGAGGTTCGACACCATTCACCATGTGAAGCATTGCTCGCGCTTGATCAGGAATCCTGTTCCGGACCATTTC
TTTTTGATTGAGGTTCCTGTGCGGATGAATTCTAGTATGGATGATGAATAG
Gene >Ophcf2|03861
ATGGCATCATCTAGTCTTCCGTTTCTAAACCATGACCAGGACAAGGCGGAGAGCGATCTGGACATATCAGACCAT
GAGCTGGGAGCAAGACGGAAGCGTCGATGCCACAGGAGAGAATGGCGACGTCTTCACTCTGTCGGTCATGTCGTT
GTTTTCCTCCTCGCCAGCTGGGGCCTCATTGCCCTCTGTCTTGAGATTGCCCAACGCATCACAAGCCAGCAATGG
CTCTTCCGATCGGAAACCCCTGACCCTTATCATCCCGAGACCCTAGAACCAGGACGCAACAGCTGCCACTGCGGC
AACACCATCAAGGAGGCTCTCTCACTCGGCTGCGTCTACGACACCATGGCAACAGCCTGGCTCCCTCCATACTGC
CGCGACGAGAAGCTAACAGCCGAGTTCGACCGCTCCGGTCCCGGTCCGGAAGGGCAGTGGTCCTACTTCGCCGAT
AAGGCAGGGACGGTGCCGCTCAGCACAGCGGAGATGGCCCGTCTAGGAGAGACGGACGGGTCGTTTTGGGCGTCG
AGAGATTGGCATATTGTTCACTGTCTTTTCTACTGGCAGAAGTATATCCGGATGCGCGAGACGGGCGTCATCATG
GAGCAGAGGTTCGACACCATTCACCATGTGAAGCATTGCTCGCGCTTGATCAGGAATCCTGTTCCGGACCATTTC
TTTTTGATTGAGGTTCCTGTGCGGATGAATTCTAGTATGGATGATGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail