Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03861
Gene name
Locationscaffold_04:146218..146944
Strand+
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole|Golgi apparatus Signal peptide|Transmembrane domain 0.1655 0.1418 0.211 0.2679 0.0637 0.0057 0.43 0.5908 0.699 0.0206

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 46 68 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1966
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3020
Ophiocordyceps australis map64 (Brazil) OphauB2|5797
Ophiocordyceps camponoti-floridani Ophcf2|03861 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4041
Ophiocordyceps kimflemingae Ophio5|1646
Ophiocordyceps subramaniannii Hirsu2|2143

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03861
MASSSLPFLNHDQDKAESDLDISDHELGARRKRRCHRREWRRLHSVGHVVVFLLASWGLIALCLEIAQRITSQQW
LFRSETPDPYHPETLEPGRNSCHCGNTIKEALSLGCVYDTMATAWLPPYCRDEKLTAEFDRSGPGPEGQWSYFAD
KAGTVPLSTAEMARLGETDGSFWASRDWHIVHCLFYWQKYIRMRETGVIMEQRFDTIHHVKHCSRLIRNPVPDHF
FLIEVPVRMNSSMDDE*
Coding >Ophcf2|03861
ATGGCATCATCTAGTCTTCCGTTTCTAAACCATGACCAGGACAAGGCGGAGAGCGATCTGGACATATCAGACCAT
GAGCTGGGAGCAAGACGGAAGCGTCGATGCCACAGGAGAGAATGGCGACGTCTTCACTCTGTCGGTCATGTCGTT
GTTTTCCTCCTCGCCAGCTGGGGCCTCATTGCCCTCTGTCTTGAGATTGCCCAACGCATCACAAGCCAGCAATGG
CTCTTCCGATCGGAAACCCCTGACCCTTATCATCCCGAGACCCTAGAACCAGGACGCAACAGCTGCCACTGCGGC
AACACCATCAAGGAGGCTCTCTCACTCGGCTGCGTCTACGACACCATGGCAACAGCCTGGCTCCCTCCATACTGC
CGCGACGAGAAGCTAACAGCCGAGTTCGACCGCTCCGGTCCCGGTCCGGAAGGGCAGTGGTCCTACTTCGCCGAT
AAGGCAGGGACGGTGCCGCTCAGCACAGCGGAGATGGCCCGTCTAGGAGAGACGGACGGGTCGTTTTGGGCGTCG
AGAGATTGGCATATTGTTCACTGTCTTTTCTACTGGCAGAAGTATATCCGGATGCGCGAGACGGGCGTCATCATG
GAGCAGAGGTTCGACACCATTCACCATGTGAAGCATTGCTCGCGCTTGATCAGGAATCCTGTTCCGGACCATTTC
TTTTTGATTGAGGTTCCTGTGCGGATGAATTCTAGTATGGATGATGAATAG
Transcript >Ophcf2|03861
ATGGCATCATCTAGTCTTCCGTTTCTAAACCATGACCAGGACAAGGCGGAGAGCGATCTGGACATATCAGACCAT
GAGCTGGGAGCAAGACGGAAGCGTCGATGCCACAGGAGAGAATGGCGACGTCTTCACTCTGTCGGTCATGTCGTT
GTTTTCCTCCTCGCCAGCTGGGGCCTCATTGCCCTCTGTCTTGAGATTGCCCAACGCATCACAAGCCAGCAATGG
CTCTTCCGATCGGAAACCCCTGACCCTTATCATCCCGAGACCCTAGAACCAGGACGCAACAGCTGCCACTGCGGC
AACACCATCAAGGAGGCTCTCTCACTCGGCTGCGTCTACGACACCATGGCAACAGCCTGGCTCCCTCCATACTGC
CGCGACGAGAAGCTAACAGCCGAGTTCGACCGCTCCGGTCCCGGTCCGGAAGGGCAGTGGTCCTACTTCGCCGAT
AAGGCAGGGACGGTGCCGCTCAGCACAGCGGAGATGGCCCGTCTAGGAGAGACGGACGGGTCGTTTTGGGCGTCG
AGAGATTGGCATATTGTTCACTGTCTTTTCTACTGGCAGAAGTATATCCGGATGCGCGAGACGGGCGTCATCATG
GAGCAGAGGTTCGACACCATTCACCATGTGAAGCATTGCTCGCGCTTGATCAGGAATCCTGTTCCGGACCATTTC
TTTTTGATTGAGGTTCCTGTGCGGATGAATTCTAGTATGGATGATGAATAG
Gene >Ophcf2|03861
ATGGCATCATCTAGTCTTCCGTTTCTAAACCATGACCAGGACAAGGCGGAGAGCGATCTGGACATATCAGACCAT
GAGCTGGGAGCAAGACGGAAGCGTCGATGCCACAGGAGAGAATGGCGACGTCTTCACTCTGTCGGTCATGTCGTT
GTTTTCCTCCTCGCCAGCTGGGGCCTCATTGCCCTCTGTCTTGAGATTGCCCAACGCATCACAAGCCAGCAATGG
CTCTTCCGATCGGAAACCCCTGACCCTTATCATCCCGAGACCCTAGAACCAGGACGCAACAGCTGCCACTGCGGC
AACACCATCAAGGAGGCTCTCTCACTCGGCTGCGTCTACGACACCATGGCAACAGCCTGGCTCCCTCCATACTGC
CGCGACGAGAAGCTAACAGCCGAGTTCGACCGCTCCGGTCCCGGTCCGGAAGGGCAGTGGTCCTACTTCGCCGAT
AAGGCAGGGACGGTGCCGCTCAGCACAGCGGAGATGGCCCGTCTAGGAGAGACGGACGGGTCGTTTTGGGCGTCG
AGAGATTGGCATATTGTTCACTGTCTTTTCTACTGGCAGAAGTATATCCGGATGCGCGAGACGGGCGTCATCATG
GAGCAGAGGTTCGACACCATTCACCATGTGAAGCATTGCTCGCGCTTGATCAGGAATCCTGTTCCGGACCATTTC
TTTTTGATTGAGGTTCCTGTGCGGATGAATTCTAGTATGGATGATGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail