Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03860
Gene name
Locationscaffold_04:144426..145582
Strand+
Gene length (bp)1156
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11807 UstYa Mycotoxin biosynthesis protein UstYa 1.0E-48 28 246

GO

GO Term Description Terminal node
GO:0043386 mycotoxin biosynthetic process Yes
GO:0044249 cellular biosynthetic process No
GO:0009404 toxin metabolic process No
GO:0008152 metabolic process No
GO:0009403 toxin biosynthetic process No
GO:0019748 secondary metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0043385 mycotoxin metabolic process No
GO:0009058 biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044550 secondary metabolite biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 37 59 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.05 0.00 0.25
Alive In ants, during behavior modification 2.84 0.18 5.49
Dead In ants, recently dead 1.82 0.00 3.80

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.284330 no
Alive Dead 0.292726 no
Dead Fungus 0.284330 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03860
MAKYFKIEASPWKDGEDGGQDTQESRIPPRRSLLSRAVAIQAVFLIANLIILLFNVYTWHSVRSHADPHNPTPFR
NVISYEARPFDVQAIYLENGTLNPHKTNSFNGPPRRDFEEAWEKLMKHQNVRVPEDELGQYAGDQSIVKLEDGSG
YYTTVAVFHGLHCIRRLHHALYPEHYYPGLSEEETFILKRHTEHCLDWLRQYVQCNADTTLIPIQWAVDSPGPVS
TDKGKHQCAVWEPIYEWMAEHSFNPFEPGLLVHPTFGNPYDKSAKHGPSLGIAPLGKGGLFHGKSAHG*
Coding >Ophcf2|03860
ATGGCAAAATACTTCAAGATCGAAGCCTCGCCGTGGAAAGATGGAGAGGATGGCGGCCAGGACACGCAAGAGAGT
CGCATACCGCCGCGGCGCTCGCTGCTCAGTCGAGCAGTAGCCATCCAAGCCGTCTTCCTCATCGCCAACTTGATC
ATTCTTCTGTTCAACGTCTACACGTGGCACTCAGTCCGAAGCCATGCCGACCCTCATAACCCGACTCCTTTTCGA
AACGTCATCTCGTACGAAGCACGGCCCTTCGACGTTCAGGCCATCTACCTCGAGAACGGGACCCTCAACCCTCAC
AAGACAAACTCGTTCAACGGACCACCGCGGAGAGACTTTGAAGAAGCGTGGGAAAAGCTCATGAAGCATCAAAAC
GTCCGGGTTCCGGAAGATGAGCTGGGGCAGTACGCCGGCGACCAGTCCATCGTCAAACTCGAAGATGGAAGCGGC
TATTACACCACCGTCGCCGTCTTCCACGGCCTTCACTGCATTCGGAGGCTTCACCACGCCTTGTATCCCGAGCAC
TATTATCCAGGTCTCTCAGAAGAGGAGACGTTCATCTTGAAGCGCCATACTGAGCACTGCCTCGACTGGCTGAGA
CAGTATGTGCAGTGCAACGCTGACACGACCCTCATTCCAATCCAATGGGCCGTCGACTCTCCCGGACCGGTTTCG
ACCGACAAGGGGAAACACCAGTGTGCTGTCTGGGAGCCCATCTACGAATGGATGGCCGAGCATTCCTTCAACCCG
TTCGAGCCCGGTCTTCTCGTCCACCCAACTTTTGGAAATCCTTATGACAAGTCGGCTAAGCACGGGCCGAGCTTG
GGGATTGCTCCGCTTGGGAAAGGCGGGTTGTTTCACGGAAAGTCGGCACATGGCTGA
Transcript >Ophcf2|03860
ATGGCAAAATACTTCAAGATCGAAGCCTCGCCGTGGAAAGATGGAGAGGATGGCGGCCAGGACACGCAAGAGAGT
CGCATACCGCCGCGGCGCTCGCTGCTCAGTCGAGCAGTAGCCATCCAAGCCGTCTTCCTCATCGCCAACTTGATC
ATTCTTCTGTTCAACGTCTACACGTGGCACTCAGTCCGAAGCCATGCCGACCCTCATAACCCGACTCCTTTTCGA
AACGTCATCTCGTACGAAGCACGGCCCTTCGACGTTCAGGCCATCTACCTCGAGAACGGGACCCTCAACCCTCAC
AAGACAAACTCGTTCAACGGACCACCGCGGAGAGACTTTGAAGAAGCGTGGGAAAAGCTCATGAAGCATCAAAAC
GTCCGGGTTCCGGAAGATGAGCTGGGGCAGTACGCCGGCGACCAGTCCATCGTCAAACTCGAAGATGGAAGCGGC
TATTACACCACCGTCGCCGTCTTCCACGGCCTTCACTGCATTCGGAGGCTTCACCACGCCTTGTATCCCGAGCAC
TATTATCCAGGTCTCTCAGAAGAGGAGACGTTCATCTTGAAGCGCCATACTGAGCACTGCCTCGACTGGCTGAGA
CAGTATGTGCAGTGCAACGCTGACACGACCCTCATTCCAATCCAATGGGCCGTCGACTCTCCCGGACCGGTTTCG
ACCGACAAGGGGAAACACCAGTGTGCTGTCTGGGAGCCCATCTACGAATGGATGGCCGAGCATTCCTTCAACCCG
TTCGAGCCCGGTCTTCTCGTCCACCCAACTTTTGGAAATCCTTATGACAAGTCGGCTAAGCACGGGCCGAGCTTG
GGGATTGCTCCGCTTGGGAAAGGCGGGTTGTTTCACGGAAAGTCGGCACATGGCTGA
Gene >Ophcf2|03860
ATGGCAAAATACTTCAAGATCGAAGCCTCGCCGTGGAAAGATGGAGAGGATGGCGGCCAGGACACGCAAGAGAGT
CGCATACCGCCGCGGCGCTCGCTGCTCAGTCGAGCAGTAGCCATCCAAGCCGTCTTCCTCATCGCCAACTTGATC
ATTCTTCTGTTCAACGTCTACACGTGGCACTCAGTCCGAAGCCATGCCGACCCTCATAACCCGAGTTTGTCTATG
TGGCTCAGGAGTGAAAAGAGATGACAAGCTAATGCAAACACAACAGCTCCTTTTCGAAACGTCATCTCGTACGAA
GCACGGCCCTTCGACGTTCAGGCCATCTACCTCGAGAACGGGACCCTCAACCCTCACAAGACAAACTCGTTCAAC
GGACCACCGCGGAGAGACTTTGAAGAAGCGTGGGAAAAGCTCATGAAGCGTGGGACTCCCTCCGTCTTCTTGACA
CCCGTAATGTACTTACCGTCGTCTCAGATCAAAACGTCCGGGTTCCGGAAGATGAGCTGGGGCAGTACGCCGGCG
ACCAGTCCATCGTCAAACTCGAAGATGGAAGCGGCTATTACACCACCGTCGCCGTCTTCCACGGCCTTCACTGCA
TTCGGAGGCTTCACCACGCCTTGTATCCCGAGCACTATTATCCAGGTCTCTCAGAAGAGGAGACGTTCATCTTGA
AGCGCCATACTGGTAAGACGGTCTCGTCTAGCCGAGTTCTTGCGTCTAACGGTCGCCTTGATTAGAGCACTGCCT
CGACTGGCTGAGACAGTATGTGCAGTGCAACGCTGACACGACCCTCATTCCAATCCAATGGGCCGTCGAGTGAGT
CGCCCCAGTTTCCGCGGACTCTGTCCAGATCCTAATTCGAGACTGGCAGCTCTCCCGGACCGGTTTCGACCGACA
AGGGGAAACACCAGTGTGCTGTCTGGGAGCCCATCTACGAATGGATGGCCGAGCATTCCTTCAACCCGTTCGAGC
CCGGTCTTCTCGTCCACCCAACTTTTGGTGAGCGCCGCTTGGTTCGTGGCTGCGGTGATCTTTTGGCTGACCATG
TTGAGCAGGAAATCCTTATGACAAGTCGGCTAAGCACGGGCCGAGCTTGGGGATTGCTCCGCTTGGGAAAGGCGG
GTTGTTTCACGGAAAGTCGGCACATGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail