Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03858
Gene name
Locationscaffold_04:137842..139430
Strand+
Gene length (bp)1588
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 2.3E-51 9 339
PF11954 DUF3471 Domain of unknown function (DUF3471) 1.7E-11 404 504

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8195 0.2879 0.1962 0.1033 0.0752 0.015 0.2324 0.0533 0.1947 0.0193

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|115
Ophiocordyceps camponoti-floridani Ophcf2|03858 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05282
Ophiocordyceps camponoti-rufipedis Ophun1|4044
Ophiocordyceps camponoti-rufipedis Ophun1|7452
Ophiocordyceps kimflemingae Ophio5|1649
Ophiocordyceps kimflemingae Ophio5|4067
Ophiocordyceps subramaniannii Hirsu2|1745
Ophiocordyceps subramaniannii Hirsu2|1988
Ophiocordyceps subramaniannii Hirsu2|230
Ophiocordyceps subramaniannii Hirsu2|2822
Ophiocordyceps subramaniannii Hirsu2|5585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03858
MDLFRSADFAAYVKKLIERHHVPGLSIAIVQDGKVASAAYGKASLEPPRDCSPDTLFYVGSLVKSLTAASAGLLV
EDDEYPEVQFEAPMAKLLPGDFVMPGEEHDHVTLEDVLCHRTGMAPHEYSILGPRAKKPDTPQSVTRNLRNLSVM
APNRAEHNYCNMLYTAVTYLIEQVSGTSFYDFLRKNILDPLDMKSTFALRDQVQQAGLDNKLATGYTWEKAKGKN
RKVVVDDSPEAQGAGQMYSTVLDYAKWIKAMLEHGGPLTEKLATTLTTKRIQRDPEDDPEQETCTFYALGWQVQQ
YSGYKIVSHDGNEPGFKCSNFFLPELNFGGVIFANSDVADTVVSLLMYRMIDDVAQHGSNGRAIREEGLGSESES
ESESVPDDDEDDDGLEDELREELSPGLEKPEPQKLPLSTYTATYSHPGYHDFTVQVKDDALFIDATDRSYGFTLT
FKHICEQTKYICYMVLSVDPQDTPIKAEFRLEGDKAVKMGLNLQEWNDEYVWFERVE*
Coding >Ophcf2|03858
ATGGATCTGTTCCGTTCCGCCGACTTTGCGGCCTACGTGAAGAAGCTGATCGAGCGCCACCACGTGCCTGGTCTG
TCTATTGCCATCGTCCAAGATGGAAAGGTGGCTTCGGCTGCTTATGGCAAGGCATCGCTTGAACCCCCCCGAGAC
TGCAGCCCCGACACGCTCTTTTACGTCGGCTCGTTGGTCAAGTCGTTGACGGCCGCGTCCGCGGGCTTGCTGGTG
GAAGACGACGAGTATCCGGAAGTGCAGTTCGAAGCGCCCATGGCGAAGCTCTTACCTGGCGACTTTGTCATGCCC
GGGGAAGAACACGACCATGTCACGCTGGAAGACGTGCTCTGCCACCGAACCGGCATGGCTCCCCACGAGTACTCT
ATCCTCGGCCCCCGGGCCAAGAAGCCGGACACGCCGCAATCCGTGACGAGGAACCTCCGGAACCTCTCCGTCATG
GCGCCGAACCGGGCCGAGCACAACTACTGTAACATGCTGTACACGGCCGTCACCTACCTGATAGAACAGGTCAGC
GGCACGAGCTTCTACGACTTTTTGCGCAAGAACATCTTGGACCCTCTCGACATGAAGTCGACGTTTGCCCTCAGA
GACCAAGTCCAACAAGCTGGCCTCGACAATAAGCTGGCCACCGGCTACACATGGGAAAAGGCCAAGGGGAAGAAC
CGCAAGGTGGTGGTTGACGACAGCCCCGAGGCTCAGGGCGCGGGCCAGATGTACTCGACCGTCCTTGACTATGCC
AAATGGATCAAGGCCATGCTCGAGCATGGGGGGCCCCTGACGGAAAAGCTGGCCACTACACTGACGACGAAGCGT
ATACAACGGGATCCTGAGGACGATCCGGAGCAGGAAACGTGTACGTTTTACGCTCTTGGCTGGCAGGTGCAGCAG
TACAGCGGCTACAAGATCGTCTCCCACGATGGAAACGAGCCCGGCTTCAAGTGCAGCAACTTCTTCCTGCCCGAA
CTCAACTTTGGCGGCGTCATTTTTGCGAACTCGGACGTGGCCGATACCGTCGTCAGCCTGCTCATGTACCGCATG
ATCGACGACGTGGCGCAGCATGGTTCCAACGGAAGGGCCATTCGCGAGGAGGGTCTCGGGTCCGAGTCCGAGTCC
GAGTCCGAGTCTGTTCCTGACGATGACGAGGATGACGATGGGTTGGAAGATGAGCTTCGCGAGGAGCTTAGCCCC
GGTCTGGAGAAGCCTGAGCCGCAGAAGTTGCCGCTGAGCACTTATACCGCTACCTACTCGCACCCAGGCTACCAC
GACTTTACGGTTCAGGTCAAGGACGACGCGCTCTTCATCGACGCCACCGACCGGTCTTACGGCTTCACCCTCACT
TTCAAGCACATCTGCGAGCAGACAAAGTACATTTGCTACATGGTCTTGTCCGTCGACCCTCAGGACACGCCCATC
AAAGCCGAGTTCCGGCTTGAGGGTGACAAGGCCGTTAAGATGGGGCTGAATCTGCAGGAATGGAACGACGAGTAC
GTCTGGTTCGAACGGGTTGAATGA
Transcript >Ophcf2|03858
ATGGATCTGTTCCGTTCCGCCGACTTTGCGGCCTACGTGAAGAAGCTGATCGAGCGCCACCACGTGCCTGGTCTG
TCTATTGCCATCGTCCAAGATGGAAAGGTGGCTTCGGCTGCTTATGGCAAGGCATCGCTTGAACCCCCCCGAGAC
TGCAGCCCCGACACGCTCTTTTACGTCGGCTCGTTGGTCAAGTCGTTGACGGCCGCGTCCGCGGGCTTGCTGGTG
GAAGACGACGAGTATCCGGAAGTGCAGTTCGAAGCGCCCATGGCGAAGCTCTTACCTGGCGACTTTGTCATGCCC
GGGGAAGAACACGACCATGTCACGCTGGAAGACGTGCTCTGCCACCGAACCGGCATGGCTCCCCACGAGTACTCT
ATCCTCGGCCCCCGGGCCAAGAAGCCGGACACGCCGCAATCCGTGACGAGGAACCTCCGGAACCTCTCCGTCATG
GCGCCGAACCGGGCCGAGCACAACTACTGTAACATGCTGTACACGGCCGTCACCTACCTGATAGAACAGGTCAGC
GGCACGAGCTTCTACGACTTTTTGCGCAAGAACATCTTGGACCCTCTCGACATGAAGTCGACGTTTGCCCTCAGA
GACCAAGTCCAACAAGCTGGCCTCGACAATAAGCTGGCCACCGGCTACACATGGGAAAAGGCCAAGGGGAAGAAC
CGCAAGGTGGTGGTTGACGACAGCCCCGAGGCTCAGGGCGCGGGCCAGATGTACTCGACCGTCCTTGACTATGCC
AAATGGATCAAGGCCATGCTCGAGCATGGGGGGCCCCTGACGGAAAAGCTGGCCACTACACTGACGACGAAGCGT
ATACAACGGGATCCTGAGGACGATCCGGAGCAGGAAACGTGTACGTTTTACGCTCTTGGCTGGCAGGTGCAGCAG
TACAGCGGCTACAAGATCGTCTCCCACGATGGAAACGAGCCCGGCTTCAAGTGCAGCAACTTCTTCCTGCCCGAA
CTCAACTTTGGCGGCGTCATTTTTGCGAACTCGGACGTGGCCGATACCGTCGTCAGCCTGCTCATGTACCGCATG
ATCGACGACGTGGCGCAGCATGGTTCCAACGGAAGGGCCATTCGCGAGGAGGGTCTCGGGTCCGAGTCCGAGTCC
GAGTCCGAGTCTGTTCCTGACGATGACGAGGATGACGATGGGTTGGAAGATGAGCTTCGCGAGGAGCTTAGCCCC
GGTCTGGAGAAGCCTGAGCCGCAGAAGTTGCCGCTGAGCACTTATACCGCTACCTACTCGCACCCAGGCTACCAC
GACTTTACGGTTCAGGTCAAGGACGACGCGCTCTTCATCGACGCCACCGACCGGTCTTACGGCTTCACCCTCACT
TTCAAGCACATCTGCGAGCAGACAAAGTACATTTGCTACATGGTCTTGTCCGTCGACCCTCAGGACACGCCCATC
AAAGCCGAGTTCCGGCTTGAGGGTGACAAGGCCGTTAAGATGGGGCTGAATCTGCAGGAATGGAACGACGAGTAC
GTCTGGTTCGAACGGGTTGAATGA
Gene >Ophcf2|03858
ATGGATCTGTTCCGTTCCGCCGACTTTGCGGCCTACGTGAAGAAGCTGATCGAGCGCCACCACGTGCCTGGTCTG
TCTATTGCCATCGTCCAAGATGGAAAGGTGGCTTCGGCTGCTTATGGCAAGGCATCGCTTGAACCCCCCCGAGAC
TGCAGCCCCGACACGCTCTTTTACGTCGGCTCGTTGGTCAAGTCGTTGACGGCCGCGTCCGCGGGCTTGCTGGTG
GAAGACGACGAGTATCCGGAAGTGCAGTTCGAAGCGCCCATGGCGAAGCTCTTACCTGGCGACTTTGTCATGCCC
GGGGAAGAACACGACCATGTCACGCTGGAAGACGTGCTCTGCCACCGAACCGGCATGGCTCCGTGAGTCGATACA
TGTCCGAATGTGCTACAGCGAGAGACGACTAACAAGATATACGCTTGACAGCCACGAGTACTCTATCCTCGGCCC
CCGGGCCAAGAAGCCGGACACGCCGCAATCCGTGACGAGGAACCTCCGGAACCTCTCCGTCATGGCGCCGAACCG
GGCCGAGCACAACTACTGTAACATGCTGTACACGGCCGTCACCTACCTGATAGAACAGGTCAGCGGCACGAGCTT
CTACGACTTTTTGCGCAAGAACATCTTGGACCCTCTCGACATGAAGTCGACGTTTGCCCTCAGAGACCAAGTCCA
ACAAGCTGGCCTCGACAATAAGCTGGCCACCGGCTACACATGGGAAAAGGCCAAGGGGAAGAACCGCAAGGTGGT
GGTTGACGACAGCCCCGAGGCTCAGGGCGCGGGCCAGATGTACTCGACCGTCCTTGACTATGCCAAATGGATCAA
GGCCATGCTCGAGCATGGGGGGCCCCTGACGGAAAAGCTGGCCACTACACTGACGACGAAGCGTATACAACGGGA
TCCTGAGGACGATCCGGAGCAGGAAACGTGTACGTTTTACGCTCTTGGCTGGCAGGTGCAGCAGTACAGCGGCTA
CAAGATCGTCTCCCACGATGGAAACGAGCCCGGCTTCAAGTGCAGCAACTTCTTCCTGCCCGAACTCAACTTTGG
CGGCGTCATTTTTGCGAACTCGGACGTGGCCGATACCGTCGTCAGCCTGCTCATGTACCGCATGATCGACGACGT
GGCGCAGCATGGTTCCAACGGAAGGGCCATTCGCGAGGAGGGTCTCGGGTCCGAGTCCGAGTCCGAGTCCGAGTC
TGTTCCTGACGATGACGAGGATGACGATGGGTTGGAAGATGAGCTTCGCGAGGAGCTTAGCCCCGGTCTGGAGAA
GCCTGAGCCGCAGAAGTTGCCGCTGAGCACTTATACCGCTACCTACTCGCACCCAGGCTACCACGACTTTACGGT
TCAGGTCAAGGACGACGCGCTCTTCATCGACGCCACCGACCGGTCTTACGGCTTCACCCTCACTTTCAAGCACAT
CTGCGAGCAGACAAAGTACATTTGCTACATGGTCTTGTCCGTCGACCCTCAGGACACGCCCATCAAAGCCGAGTT
CCGGCTTGAGGGTGACAAGGCCGTTAAGATGGGGCTGAATCTGCAGGAATGGAACGACGAGTACGTCTGGTTCGA
ACGGGTTGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail