Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03855
Gene name
Locationscaffold_04:125956..131003
Strand-
Gene length (bp)5047
Transcript length (bp)4989
Coding sequence length (bp)4989
Protein length (aa) 1663

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.3E-09 141 399

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 864 886 22
2 907 929 22
3 955 972 17
4 1111 1133 22
5 1168 1190 22
6 1418 1440 22
7 1460 1482 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 8.08 4.30 11.86
Alive In ants, during behavior modification 5.11 2.45 7.77
Dead In ants, recently dead 3.28 1.42 5.14

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.034573 yes
Alive Dead 0.024555 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03855
MHVDWLSEGSDELARRISQLYRLPPATVSESSLFRNILTDASLSKGVLLASIPTCNNQPYRPLHIFYLIVTEVGG
SWPSFALFYHFLRLRRRLPETGHQDEAAWLVQSAESIVRESYGSLADFVAGADEAVLRTVRGDIFMTHRQLGRFV
DGFALPSLGSPESRIVVAVIIPDEPLMAAVCVAVATYYVVVPLNVEAELDQIKADLERVQANCVVTTPEVLQDGR
LVRMGAWLERQKMAIFTTEMDAEERGRIVVRDRHLRPLSAAVPGSLRRNGPADAAVLLFNKGIWGTRGLVTLTTH
GLIKEAIEAVEAWRLVPRDVCFNMAPVDDMGGLTRGVMAAIVSGGSVVCCSRTSPRLFWDALPELRLTWCLASLA
KLKLILSEAPFHPQTAWQNTLRLACRSDGFIPADMAALIEETFHCDIASADRSPVRPQLTLSHSAVGSLDERDDA
RYAEESDEEESEKYSSTTLTAYTTDWFSSGHDSHAKEKLDDYLDDDGYLRVMGASKEVIHSGKRAIDPQAVEKAI
MTASESPDSPIHNRVAAVLAFSMAHETQGEAVAVVVVPSPEVLRVDLRTLHDALRASPLDDARWPHSIVYMSRLP
MRRGKPLRARLGARLGLPELSDETPYAARHWEATCPPPDTSLMTPIEVLGCRVDVEAITATLAAVAPSRFRVHVE
ECPEASGYDVFLAPESASAAGMLPPGGAEHFRRLMNASLVAEGHAGLPGNLHILDDPLPLGPDGVPDRARLAEMQ
AELHRDMLPTPVRHAEDRVERAFAEVLGRGPYHAPLDREAGFYRIGGNSRKAKLLLAALRVDFNLPLPADLLTPP
RTGSVRAVAAFVEARMRDEQAAPRGHGCTETYSSTRPWLLILQLLPLVFLYPLLLTMGASFQMFILSKTRFWRTV
ELVGGRLANLLVSLMTTWITLQIIIPWFGIAAKWLIIGRYREGVYPMWGPYHTRWWMVQKMVMICGMGIFDISDR
GRILYHRLMGAKIGRDVHISDVTLGEWDLLDIRDGARLERCHCRPFAAEENSSMYLGRIVIGERASVGLMSVLAP
GTEVLPDTRIGANSSSWEQADSWSGPTPGPAGTWPDVEAGAEPAPPIPEPHWLLTLLLTMPIYLIGWFISMLPWL
VVLIGMLYQPPKRSTIPVRVIADYYQSSPAVAYNYLSDGSSVAFSPLLFFLFAVAVRAITRAVAGDLPTKSAEIR
SSLHAWRIALIRTLFPEKQLKALNDMLGHHNEARSGVLRMLGARVGRRVCWPTVGPVVRDYHLVDIGDDVTFGES
CFLQTYEDGDSGVISIGNGAVISDHVCIMPGVSVGERTTLGFGTLTRRGRHYQSGKAFIGCRAGDAARSHSVGGG
ILWPVPDGFGRLRHADSAETLVPSNTTTPMGSMPSSSRSSTTPENSPYNRAVYMKDASYRVLSPTKTLIFSFSMT
LFTTFYWNVAALSSMKLACRFFVQFFLGIDSTYDILVIFGLDLACSMVLLTTFAVLALSAVILSKRFLIGKFEPG
VYDWDKSPMCQRWQLLTAIEKIIRRCYVDKGILSMLTGTHWLVLYYRALGVKIGKDCSLFANGYPSLLITAADLV
EIGDRVVLDDVGLVSHMDRRGSVRLDHIKIGHRCVLRTGSNILYGAEMRDESCLLEHTLVLPGEVVKEKWTMQRR
PAERFYGSRKGT*
Coding >Ophcf2|03855
ATGCATGTTGATTGGCTATCCGAAGGCTCCGATGAGCTGGCGAGACGCATCTCGCAGCTCTACCGGTTGCCGCCT
GCGACGGTCAGCGAAAGCAGTCTCTTCCGCAATATCTTGACGGATGCTTCGCTCAGTAAGGGGGTGCTGCTAGCT
TCTATCCCGACTTGCAACAACCAACCTTACCGACCGCTTCACATTTTCTACCTGATTGTTACCGAGGTGGGCGGA
TCATGGCCCTCGTTTGCGCTCTTTTATCACTTTCTCAGGCTGCGGAGGCGGCTTCCGGAGACGGGACACCAGGAT
GAGGCGGCGTGGTTGGTTCAGAGTGCTGAGAGCATCGTTAGGGAGTCTTATGGCTCGCTGGCGGATTTCGTTGCT
GGGGCGGATGAGGCTGTTTTGAGGACTGTTAGGGGGGATATCTTTATGACGCATCGGCAGCTGGGAAGGTTTGTC
GATGGCTTTGCTCTTCCGTCGTTGGGGTCGCCTGAGAGTCGGATCGTCGTGGCTGTCATCATCCCCGATGAGCCG
CTGATGGCAGCCGTCTGCGTGGCGGTGGCGACGTACTACGTTGTCGTTCCGCTGAATGTGGAAGCGGAACTCGAT
CAGATCAAGGCGGATCTGGAGAGGGTACAGGCTAACTGTGTTGTCACGACGCCCGAGGTGCTTCAGGACGGCCGA
CTGGTACGGATGGGAGCCTGGCTTGAGAGACAGAAGATGGCCATCTTTACGACCGAGATGGACGCCGAGGAACGG
GGCCGGATCGTGGTCAGGGATCGGCATCTTCGACCTCTATCGGCTGCTGTTCCCGGTTCTCTGCGACGGAATGGA
CCGGCTGACGCGGCGGTCTTGCTGTTCAACAAGGGAATCTGGGGGACGAGGGGGTTGGTGACCCTCACGACGCAT
GGCTTGATAAAGGAGGCCATCGAAGCGGTTGAGGCCTGGAGACTCGTTCCCCGAGATGTGTGTTTCAACATGGCT
CCCGTCGACGACATGGGCGGTCTTACACGCGGAGTCATGGCCGCCATCGTTTCAGGAGGATCCGTCGTGTGCTGT
TCCAGGACGAGCCCTCGACTCTTCTGGGATGCGTTGCCGGAGCTGAGACTTACATGGTGTCTGGCTTCGTTGGCA
AAGTTGAAGCTCATCCTTTCTGAGGCACCCTTTCATCCGCAGACGGCGTGGCAGAATACTCTGCGGTTGGCGTGC
CGGTCCGATGGCTTCATCCCGGCTGATATGGCGGCCTTGATCGAGGAGACGTTTCACTGCGATATTGCCTCTGCG
GATCGTTCACCGGTACGACCGCAACTTACTCTCTCTCACTCCGCCGTCGGCTCCCTCGACGAAAGAGACGACGCG
CGATACGCAGAAGAATCGGACGAAGAAGAATCCGAAAAGTACTCTTCCACTACTCTGACGGCCTACACCACAGAC
TGGTTCAGCAGCGGTCACGACTCACACGCGAAGGAGAAGCTTGACGATTACCTCGACGACGATGGCTACCTTCGC
GTAATGGGCGCCTCTAAGGAAGTCATCCACAGCGGCAAGCGAGCCATCGACCCGCAAGCCGTGGAGAAAGCCATC
ATGACAGCCAGCGAATCACCCGACTCGCCCATTCACAACCGCGTTGCCGCCGTGCTGGCCTTTAGCATGGCTCAC
GAGACGCAGGGTGAGGCCGTGGCCGTTGTTGTCGTTCCCAGCCCGGAAGTCCTGCGTGTTGATCTCCGGACGTTG
CATGATGCGTTGAGGGCTTCGCCTCTCGACGATGCGAGGTGGCCGCATTCCATCGTCTATATGAGTCGCTTGCCT
ATGCGGCGGGGGAAACCGCTCAGAGCCCGGCTCGGTGCTCGTCTCGGTCTACCGGAGTTATCGGATGAGACGCCC
TACGCTGCTCGACACTGGGAAGCGACTTGTCCTCCACCCGACACCTCGTTGATGACGCCCATCGAGGTGCTGGGC
TGCCGCGTCGACGTCGAAGCCATCACCGCCACCCTCGCCGCCGTTGCCCCGAGCAGGTTCAGGGTACACGTGGAG
GAATGCCCCGAAGCGAGCGGATACGACGTCTTCCTCGCCCCGGAGTCGGCCTCCGCAGCCGGCATGCTCCCCCCG
GGCGGGGCCGAACACTTCCGCCGCCTGATGAACGCCTCGCTCGTGGCAGAGGGACACGCCGGATTACCGGGAAAC
CTCCACATCCTGGATGACCCGCTGCCCCTGGGGCCGGACGGGGTTCCGGACCGGGCCCGGCTGGCGGAGATGCAG
GCCGAGTTGCATCGCGATATGCTGCCGACGCCGGTGCGGCACGCCGAGGATCGGGTTGAGAGGGCCTTTGCAGAG
GTTCTTGGCAGGGGACCTTATCACGCTCCTCTCGATCGCGAGGCTGGTTTCTACCGGATCGGTGGTAACTCTCGA
AAGGCGAAACTGCTACTCGCTGCCCTCAGAGTCGACTTCAACCTCCCGCTTCCGGCAGATCTCCTGACGCCGCCG
AGGACGGGCTCCGTCCGGGCGGTAGCGGCCTTTGTCGAGGCCCGGATGCGAGACGAGCAGGCAGCTCCACGCGGA
CACGGCTGCACGGAAACCTACAGCTCGACACGACCGTGGTTGCTGATACTGCAACTGTTGCCTCTCGTATTCCTA
TACCCCCTCCTGCTGACCATGGGAGCATCCTTTCAAATGTTCATCCTCAGCAAGACGCGCTTCTGGCGGACGGTC
GAGCTGGTGGGCGGGAGGCTTGCCAACCTGCTCGTCTCGCTGATGACGACGTGGATAACGCTACAGATCATCATC
CCCTGGTTCGGAATCGCGGCCAAGTGGCTCATCATCGGCCGGTACCGCGAGGGCGTGTATCCGATGTGGGGGCCG
TATCATACGCGGTGGTGGATGGTGCAGAAGATGGTCATGATCTGCGGCATGGGCATCTTCGACATCAGCGACAGG
GGCCGCATCCTATACCACCGGCTGATGGGCGCCAAGATCGGCCGCGACGTCCACATCAGCGACGTGACTCTGGGC
GAGTGGGATCTTCTGGATATCCGGGACGGAGCCCGTCTGGAACGCTGTCACTGTCGACCCTTTGCCGCGGAGGAG
AACTCGTCCATGTATCTCGGTCGCATCGTCATCGGCGAGCGGGCTTCCGTCGGGCTCATGTCCGTCTTGGCGCCC
GGGACCGAGGTGCTCCCGGACACGCGCATCGGAGCAAACTCTTCTAGCTGGGAGCAGGCCGATTCGTGGTCCGGC
CCCACTCCCGGCCCGGCCGGCACGTGGCCCGACGTCGAGGCCGGAGCGGAGCCGGCGCCGCCTATCCCGGAGCCC
CACTGGTTGCTGACGCTGCTGCTGACGATGCCCATCTACCTGATCGGCTGGTTCATCTCGATGCTTCCCTGGCTG
GTGGTCCTCATCGGCATGCTGTACCAGCCGCCGAAACGGAGTACGATCCCGGTACGCGTCATCGCGGATTACTAC
CAGAGCAGCCCGGCGGTCGCGTACAACTATCTATCCGACGGCAGTAGCGTCGCCTTCTCCCCGCTGCTCTTCTTC
CTCTTCGCCGTCGCCGTCCGTGCCATCACCCGTGCCGTGGCCGGCGACCTACCCACCAAGTCGGCCGAGATCCGG
AGCTCGCTTCACGCGTGGCGAATCGCCCTCATCCGGACCCTCTTCCCCGAGAAGCAGCTCAAGGCTCTGAACGAT
ATGCTCGGTCACCATAACGAGGCTCGCTCCGGCGTCCTCCGGATGCTAGGAGCTCGTGTCGGTCGTCGCGTCTGC
TGGCCGACTGTCGGGCCGGTGGTGCGAGATTACCACCTCGTCGATATCGGCGACGACGTCACCTTTGGCGAGAGC
TGCTTCCTACAGACGTACGAGGACGGGGACTCGGGTGTCATCAGCATCGGGAACGGGGCCGTCATCTCCGATCAC
GTCTGCATCATGCCCGGAGTCTCCGTCGGCGAGCGAACGACGCTCGGTTTCGGCACTCTGACCCGCCGCGGACGC
CATTACCAGTCCGGCAAGGCCTTCATCGGCTGCCGAGCCGGAGACGCGGCTCGCTCTCACAGCGTCGGAGGCGGA
ATCCTTTGGCCGGTCCCGGATGGTTTCGGCCGGCTCCGTCACGCCGATAGCGCCGAGACGCTGGTGCCCTCCAAC
ACGACGACTCCCATGGGAAGCATGCCCTCGTCTTCTCGCTCCTCTACTACGCCCGAGAACTCGCCGTACAATCGA
GCCGTTTACATGAAGGATGCCTCGTACCGCGTCCTGTCGCCCACCAAGACGCTCATCTTCTCCTTTTCCATGACG
CTCTTCACCACGTTTTACTGGAATGTCGCTGCCCTTTCTTCCATGAAGCTCGCCTGCCGCTTCTTCGTGCAGTTC
TTCTTGGGAATCGACAGCACCTACGATATTCTCGTCATCTTCGGCCTCGATCTCGCCTGCTCCATGGTCCTCCTC
ACCACCTTTGCCGTCCTGGCTCTCAGCGCCGTCATCCTTTCCAAGAGGTTTCTCATCGGGAAATTCGAGCCGGGC
GTCTATGACTGGGACAAGTCGCCCATGTGTCAGCGCTGGCAGCTGCTAACGGCCATTGAAAAGATCATCCGCCGC
TGCTACGTCGACAAGGGAATCCTAAGCATGTTGACGGGCACGCACTGGCTCGTCCTCTACTACCGTGCCCTGGGC
GTCAAGATCGGAAAGGACTGCTCGCTCTTCGCAAACGGCTATCCCAGTCTGCTCATCACTGCCGCCGATCTGGTT
GAGATTGGCGACCGTGTTGTTCTCGATGACGTCGGTCTCGTCTCTCATATGGATAGAAGGGGCAGCGTGCGTCTA
GATCACATCAAGATCGGTCACCGCTGCGTCTTACGCACGGGAAGCAACATCCTCTACGGCGCCGAGATGAGAGAT
GAGAGCTGTCTGCTGGAGCACACGCTTGTTCTCCCCGGCGAGGTCGTCAAGGAGAAATGGACCATGCAGCGTCGT
CCGGCCGAGCGCTTCTACGGTTCCCGCAAAGGGACGTAG
Transcript >Ophcf2|03855
ATGCATGTTGATTGGCTATCCGAAGGCTCCGATGAGCTGGCGAGACGCATCTCGCAGCTCTACCGGTTGCCGCCT
GCGACGGTCAGCGAAAGCAGTCTCTTCCGCAATATCTTGACGGATGCTTCGCTCAGTAAGGGGGTGCTGCTAGCT
TCTATCCCGACTTGCAACAACCAACCTTACCGACCGCTTCACATTTTCTACCTGATTGTTACCGAGGTGGGCGGA
TCATGGCCCTCGTTTGCGCTCTTTTATCACTTTCTCAGGCTGCGGAGGCGGCTTCCGGAGACGGGACACCAGGAT
GAGGCGGCGTGGTTGGTTCAGAGTGCTGAGAGCATCGTTAGGGAGTCTTATGGCTCGCTGGCGGATTTCGTTGCT
GGGGCGGATGAGGCTGTTTTGAGGACTGTTAGGGGGGATATCTTTATGACGCATCGGCAGCTGGGAAGGTTTGTC
GATGGCTTTGCTCTTCCGTCGTTGGGGTCGCCTGAGAGTCGGATCGTCGTGGCTGTCATCATCCCCGATGAGCCG
CTGATGGCAGCCGTCTGCGTGGCGGTGGCGACGTACTACGTTGTCGTTCCGCTGAATGTGGAAGCGGAACTCGAT
CAGATCAAGGCGGATCTGGAGAGGGTACAGGCTAACTGTGTTGTCACGACGCCCGAGGTGCTTCAGGACGGCCGA
CTGGTACGGATGGGAGCCTGGCTTGAGAGACAGAAGATGGCCATCTTTACGACCGAGATGGACGCCGAGGAACGG
GGCCGGATCGTGGTCAGGGATCGGCATCTTCGACCTCTATCGGCTGCTGTTCCCGGTTCTCTGCGACGGAATGGA
CCGGCTGACGCGGCGGTCTTGCTGTTCAACAAGGGAATCTGGGGGACGAGGGGGTTGGTGACCCTCACGACGCAT
GGCTTGATAAAGGAGGCCATCGAAGCGGTTGAGGCCTGGAGACTCGTTCCCCGAGATGTGTGTTTCAACATGGCT
CCCGTCGACGACATGGGCGGTCTTACACGCGGAGTCATGGCCGCCATCGTTTCAGGAGGATCCGTCGTGTGCTGT
TCCAGGACGAGCCCTCGACTCTTCTGGGATGCGTTGCCGGAGCTGAGACTTACATGGTGTCTGGCTTCGTTGGCA
AAGTTGAAGCTCATCCTTTCTGAGGCACCCTTTCATCCGCAGACGGCGTGGCAGAATACTCTGCGGTTGGCGTGC
CGGTCCGATGGCTTCATCCCGGCTGATATGGCGGCCTTGATCGAGGAGACGTTTCACTGCGATATTGCCTCTGCG
GATCGTTCACCGGTACGACCGCAACTTACTCTCTCTCACTCCGCCGTCGGCTCCCTCGACGAAAGAGACGACGCG
CGATACGCAGAAGAATCGGACGAAGAAGAATCCGAAAAGTACTCTTCCACTACTCTGACGGCCTACACCACAGAC
TGGTTCAGCAGCGGTCACGACTCACACGCGAAGGAGAAGCTTGACGATTACCTCGACGACGATGGCTACCTTCGC
GTAATGGGCGCCTCTAAGGAAGTCATCCACAGCGGCAAGCGAGCCATCGACCCGCAAGCCGTGGAGAAAGCCATC
ATGACAGCCAGCGAATCACCCGACTCGCCCATTCACAACCGCGTTGCCGCCGTGCTGGCCTTTAGCATGGCTCAC
GAGACGCAGGGTGAGGCCGTGGCCGTTGTTGTCGTTCCCAGCCCGGAAGTCCTGCGTGTTGATCTCCGGACGTTG
CATGATGCGTTGAGGGCTTCGCCTCTCGACGATGCGAGGTGGCCGCATTCCATCGTCTATATGAGTCGCTTGCCT
ATGCGGCGGGGGAAACCGCTCAGAGCCCGGCTCGGTGCTCGTCTCGGTCTACCGGAGTTATCGGATGAGACGCCC
TACGCTGCTCGACACTGGGAAGCGACTTGTCCTCCACCCGACACCTCGTTGATGACGCCCATCGAGGTGCTGGGC
TGCCGCGTCGACGTCGAAGCCATCACCGCCACCCTCGCCGCCGTTGCCCCGAGCAGGTTCAGGGTACACGTGGAG
GAATGCCCCGAAGCGAGCGGATACGACGTCTTCCTCGCCCCGGAGTCGGCCTCCGCAGCCGGCATGCTCCCCCCG
GGCGGGGCCGAACACTTCCGCCGCCTGATGAACGCCTCGCTCGTGGCAGAGGGACACGCCGGATTACCGGGAAAC
CTCCACATCCTGGATGACCCGCTGCCCCTGGGGCCGGACGGGGTTCCGGACCGGGCCCGGCTGGCGGAGATGCAG
GCCGAGTTGCATCGCGATATGCTGCCGACGCCGGTGCGGCACGCCGAGGATCGGGTTGAGAGGGCCTTTGCAGAG
GTTCTTGGCAGGGGACCTTATCACGCTCCTCTCGATCGCGAGGCTGGTTTCTACCGGATCGGTGGTAACTCTCGA
AAGGCGAAACTGCTACTCGCTGCCCTCAGAGTCGACTTCAACCTCCCGCTTCCGGCAGATCTCCTGACGCCGCCG
AGGACGGGCTCCGTCCGGGCGGTAGCGGCCTTTGTCGAGGCCCGGATGCGAGACGAGCAGGCAGCTCCACGCGGA
CACGGCTGCACGGAAACCTACAGCTCGACACGACCGTGGTTGCTGATACTGCAACTGTTGCCTCTCGTATTCCTA
TACCCCCTCCTGCTGACCATGGGAGCATCCTTTCAAATGTTCATCCTCAGCAAGACGCGCTTCTGGCGGACGGTC
GAGCTGGTGGGCGGGAGGCTTGCCAACCTGCTCGTCTCGCTGATGACGACGTGGATAACGCTACAGATCATCATC
CCCTGGTTCGGAATCGCGGCCAAGTGGCTCATCATCGGCCGGTACCGCGAGGGCGTGTATCCGATGTGGGGGCCG
TATCATACGCGGTGGTGGATGGTGCAGAAGATGGTCATGATCTGCGGCATGGGCATCTTCGACATCAGCGACAGG
GGCCGCATCCTATACCACCGGCTGATGGGCGCCAAGATCGGCCGCGACGTCCACATCAGCGACGTGACTCTGGGC
GAGTGGGATCTTCTGGATATCCGGGACGGAGCCCGTCTGGAACGCTGTCACTGTCGACCCTTTGCCGCGGAGGAG
AACTCGTCCATGTATCTCGGTCGCATCGTCATCGGCGAGCGGGCTTCCGTCGGGCTCATGTCCGTCTTGGCGCCC
GGGACCGAGGTGCTCCCGGACACGCGCATCGGAGCAAACTCTTCTAGCTGGGAGCAGGCCGATTCGTGGTCCGGC
CCCACTCCCGGCCCGGCCGGCACGTGGCCCGACGTCGAGGCCGGAGCGGAGCCGGCGCCGCCTATCCCGGAGCCC
CACTGGTTGCTGACGCTGCTGCTGACGATGCCCATCTACCTGATCGGCTGGTTCATCTCGATGCTTCCCTGGCTG
GTGGTCCTCATCGGCATGCTGTACCAGCCGCCGAAACGGAGTACGATCCCGGTACGCGTCATCGCGGATTACTAC
CAGAGCAGCCCGGCGGTCGCGTACAACTATCTATCCGACGGCAGTAGCGTCGCCTTCTCCCCGCTGCTCTTCTTC
CTCTTCGCCGTCGCCGTCCGTGCCATCACCCGTGCCGTGGCCGGCGACCTACCCACCAAGTCGGCCGAGATCCGG
AGCTCGCTTCACGCGTGGCGAATCGCCCTCATCCGGACCCTCTTCCCCGAGAAGCAGCTCAAGGCTCTGAACGAT
ATGCTCGGTCACCATAACGAGGCTCGCTCCGGCGTCCTCCGGATGCTAGGAGCTCGTGTCGGTCGTCGCGTCTGC
TGGCCGACTGTCGGGCCGGTGGTGCGAGATTACCACCTCGTCGATATCGGCGACGACGTCACCTTTGGCGAGAGC
TGCTTCCTACAGACGTACGAGGACGGGGACTCGGGTGTCATCAGCATCGGGAACGGGGCCGTCATCTCCGATCAC
GTCTGCATCATGCCCGGAGTCTCCGTCGGCGAGCGAACGACGCTCGGTTTCGGCACTCTGACCCGCCGCGGACGC
CATTACCAGTCCGGCAAGGCCTTCATCGGCTGCCGAGCCGGAGACGCGGCTCGCTCTCACAGCGTCGGAGGCGGA
ATCCTTTGGCCGGTCCCGGATGGTTTCGGCCGGCTCCGTCACGCCGATAGCGCCGAGACGCTGGTGCCCTCCAAC
ACGACGACTCCCATGGGAAGCATGCCCTCGTCTTCTCGCTCCTCTACTACGCCCGAGAACTCGCCGTACAATCGA
GCCGTTTACATGAAGGATGCCTCGTACCGCGTCCTGTCGCCCACCAAGACGCTCATCTTCTCCTTTTCCATGACG
CTCTTCACCACGTTTTACTGGAATGTCGCTGCCCTTTCTTCCATGAAGCTCGCCTGCCGCTTCTTCGTGCAGTTC
TTCTTGGGAATCGACAGCACCTACGATATTCTCGTCATCTTCGGCCTCGATCTCGCCTGCTCCATGGTCCTCCTC
ACCACCTTTGCCGTCCTGGCTCTCAGCGCCGTCATCCTTTCCAAGAGGTTTCTCATCGGGAAATTCGAGCCGGGC
GTCTATGACTGGGACAAGTCGCCCATGTGTCAGCGCTGGCAGCTGCTAACGGCCATTGAAAAGATCATCCGCCGC
TGCTACGTCGACAAGGGAATCCTAAGCATGTTGACGGGCACGCACTGGCTCGTCCTCTACTACCGTGCCCTGGGC
GTCAAGATCGGAAAGGACTGCTCGCTCTTCGCAAACGGCTATCCCAGTCTGCTCATCACTGCCGCCGATCTGGTT
GAGATTGGCGACCGTGTTGTTCTCGATGACGTCGGTCTCGTCTCTCATATGGATAGAAGGGGCAGCGTGCGTCTA
GATCACATCAAGATCGGTCACCGCTGCGTCTTACGCACGGGAAGCAACATCCTCTACGGCGCCGAGATGAGAGAT
GAGAGCTGTCTGCTGGAGCACACGCTTGTTCTCCCCGGCGAGGTCGTCAAGGAGAAATGGACCATGCAGCGTCGT
CCGGCCGAGCGCTTCTACGGTTCCCGCAAAGGGACGTAG
Gene >Ophcf2|03855
ATGCATGTTGATTGGCTATCCGAAGGCTCCGATGAGCTGGCGAGACGCATCTCGCAGCTCTACCGGTTGCCGCCT
GCGACGGTCAGCGAAAGCAGTCTCTTCCGCAATATCTTGACGGATGCTTCGCTCAGTAAGGGGGTGCTGCTAGCT
TCTATCCCGACTTGCAACAACCAACCTTACCGACCGCTTCACATTTTCTACCTGATTGTTACCGAGGTGGGCGGA
TCATGGCCCTCGTTTGCGCTCTTTTATCACTTTCTCAGGCTGCGGAGGCGGCTTCCGGAGACGGGACACCAGGAT
GAGGCGGCGTGGTTGGTTCAGAGTGCTGAGAGCATCGTTAGGGAGTCTTATGGCTCGCTGGCGGATTTCGTTGCT
GGGGCGGATGAGGCTGTTTTGAGGACTGTTAGGGGGGATATCTTTATGACGCATCGGCAGCTGGGAAGGTTTGTC
GATGGCTTTGCTCTTCCGTCGTTGGGGTCGCCTGAGAGTCGGATCGTCGTGGCTGTCATCATCCCCGATGAGCCG
CTGATGGCAGCCGTCTGCGTGGCGGTGGCGACGTACTACGTTGTCGTTCCGCTGAATGTGGAAGCGGAACTCGAT
CAGATCAAGGCGGATCTGGAGAGGGTACAGGCTAACTGTGTTGTCACGACGCCCGAGGTGCTTCAGGACGGCCGA
CTGGTACGGATGGGAGCCTGGCTTGAGAGACAGAAGATGGCCATCTTTACGACCGAGATGGACGCCGAGGAACGG
GGCCGGATCGTGGTCAGGGATCGGCATCTTCGACCTCTATCGGCTGCTGTTCCCGGTTCTCTGCGACGGAATGGA
CCGGCTGACGCGGCGGTCTTGCTGTTCAACAAGGGAATCTGGGGGACGAGGGGGTTGGTGACCCTCACGACGCAT
GGCTTGATAAAGGAGGCCATCGAAGCGGTTGAGGCCTGGAGACTCGTTCCCCGAGATGTGTGTTTCAACATGGCT
CCCGTCGACGACATGGGCGGTCTTACACGCGGAGTCATGGCCGCCATCGTTTCAGGAGGATCCGTCGTGTGCTGT
TCCAGGACGAGCCCTCGACTCTTCTGGGATGCGTTGCCGGAGCTGAGACTTACATGGTGTCTGGCTTCGTTGGCA
AAGTTGAAGCTCATCCTTTCTGAGGCACCCTTTCATCCGCAGACGGCGTGGCAGAATACTCTGCGGTTGGCGTGC
CGGTCCGATGGCTTCATCCCGGCTGATATGGCGGCCTTGATCGAGGAGACGTTTCACTGCGATATTGCCTCTGCG
GATCGTTCACCGGTGTAAGTCTTGAGGATATCGTCGGTTTGACTTGGTGATTGAGTTGACTAACGGTGACAGACG
ACCGCAACTTACTCTCTCTCACTCCGCCGTCGGCTCCCTCGACGAAAGAGACGACGCGCGATACGCAGAAGAATC
GGACGAAGAAGAATCCGAAAAGTACTCTTCCACTACTCTGACGGCCTACACCACAGACTGGTTCAGCAGCGGTCA
CGACTCACACGCGAAGGAGAAGCTTGACGATTACCTCGACGACGATGGCTACCTTCGCGTAATGGGCGCCTCTAA
GGAAGTCATCCACAGCGGCAAGCGAGCCATCGACCCGCAAGCCGTGGAGAAAGCCATCATGACAGCCAGCGAATC
ACCCGACTCGCCCATTCACAACCGCGTTGCCGCCGTGCTGGCCTTTAGCATGGCTCACGAGACGCAGGGTGAGGC
CGTGGCCGTTGTTGTCGTTCCCAGCCCGGAAGTCCTGCGTGTTGATCTCCGGACGTTGCATGATGCGTTGAGGGC
TTCGCCTCTCGACGATGCGAGGTGGCCGCATTCCATCGTCTATATGAGTCGCTTGCCTATGCGGCGGGGGAAACC
GCTCAGAGCCCGGCTCGGTGCTCGTCTCGGTCTACCGGAGTTATCGGATGAGACGCCCTACGCTGCTCGACACTG
GGAAGCGACTTGTCCTCCACCCGACACCTCGTTGATGACGCCCATCGAGGTGCTGGGCTGCCGCGTCGACGTCGA
AGCCATCACCGCCACCCTCGCCGCCGTTGCCCCGAGCAGGTTCAGGGTACACGTGGAGGAATGCCCCGAAGCGAG
CGGATACGACGTCTTCCTCGCCCCGGAGTCGGCCTCCGCAGCCGGCATGCTCCCCCCGGGCGGGGCCGAACACTT
CCGCCGCCTGATGAACGCCTCGCTCGTGGCAGAGGGACACGCCGGATTACCGGGAAACCTCCACATCCTGGATGA
CCCGCTGCCCCTGGGGCCGGACGGGGTTCCGGACCGGGCCCGGCTGGCGGAGATGCAGGCCGAGTTGCATCGCGA
TATGCTGCCGACGCCGGTGCGGCACGCCGAGGATCGGGTTGAGAGGGCCTTTGCAGAGGTTCTTGGCAGGGGACC
TTATCACGCTCCTCTCGATCGCGAGGCTGGTTTCTACCGGATCGGTGGTAACTCTCGAAAGGCGAAACTGCTACT
CGCTGCCCTCAGAGTCGACTTCAACCTCCCGCTTCCGGCAGATCTCCTGACGCCGCCGAGGACGGGCTCCGTCCG
GGCGGTAGCGGCCTTTGTCGAGGCCCGGATGCGAGACGAGCAGGCAGCTCCACGCGGACACGGCTGCACGGAAAC
CTACAGCTCGACACGACCGTGGTTGCTGATACTGCAACTGTTGCCTCTCGTATTCCTATACCCCCTCCTGCTGAC
CATGGGAGCATCCTTTCAAATGTTCATCCTCAGCAAGACGCGCTTCTGGCGGACGGTCGAGCTGGTGGGCGGGAG
GCTTGCCAACCTGCTCGTCTCGCTGATGACGACGTGGATAACGCTACAGATCATCATCCCCTGGTTCGGAATCGC
GGCCAAGTGGCTCATCATCGGCCGGTACCGCGAGGGCGTGTATCCGATGTGGGGGCCGTATCATACGCGGTGGTG
GATGGTGCAGAAGATGGTCATGATCTGCGGCATGGGCATCTTCGACATCAGCGACAGGGGCCGCATCCTATACCA
CCGGCTGATGGGCGCCAAGATCGGCCGCGACGTCCACATCAGCGACGTGACTCTGGGCGAGTGGGATCTTCTGGA
TATCCGGGACGGAGCCCGTCTGGAACGCTGTCACTGTCGACCCTTTGCCGCGGAGGAGAACTCGTCCATGTATCT
CGGTCGCATCGTCATCGGCGAGCGGGCTTCCGTCGGGCTCATGTCCGTCTTGGCGCCCGGGACCGAGGTGCTCCC
GGACACGCGCATCGGAGCAAACTCTTCTAGCTGGGAGCAGGCCGATTCGTGGTCCGGCCCCACTCCCGGCCCGGC
CGGCACGTGGCCCGACGTCGAGGCCGGAGCGGAGCCGGCGCCGCCTATCCCGGAGCCCCACTGGTTGCTGACGCT
GCTGCTGACGATGCCCATCTACCTGATCGGCTGGTTCATCTCGATGCTTCCCTGGCTGGTGGTCCTCATCGGCAT
GCTGTACCAGCCGCCGAAACGGAGTACGATCCCGGTACGCGTCATCGCGGATTACTACCAGAGCAGCCCGGCGGT
CGCGTACAACTATCTATCCGACGGCAGTAGCGTCGCCTTCTCCCCGCTGCTCTTCTTCCTCTTCGCCGTCGCCGT
CCGTGCCATCACCCGTGCCGTGGCCGGCGACCTACCCACCAAGTCGGCCGAGATCCGGAGCTCGCTTCACGCGTG
GCGAATCGCCCTCATCCGGACCCTCTTCCCCGAGAAGCAGCTCAAGGCTCTGAACGATATGCTCGGTCACCATAA
CGAGGCTCGCTCCGGCGTCCTCCGGATGCTAGGAGCTCGTGTCGGTCGTCGCGTCTGCTGGCCGACTGTCGGGCC
GGTGGTGCGAGATTACCACCTCGTCGATATCGGCGACGACGTCACCTTTGGCGAGAGCTGCTTCCTACAGACGTA
CGAGGACGGGGACTCGGGTGTCATCAGCATCGGGAACGGGGCCGTCATCTCCGATCACGTCTGCATCATGCCCGG
AGTCTCCGTCGGCGAGCGAACGACGCTCGGTTTCGGCACTCTGACCCGCCGCGGACGCCATTACCAGTCCGGCAA
GGCCTTCATCGGCTGCCGAGCCGGAGACGCGGCTCGCTCTCACAGCGTCGGAGGCGGAATCCTTTGGCCGGTCCC
GGATGGTTTCGGCCGGCTCCGTCACGCCGATAGCGCCGAGACGCTGGTGCCCTCCAACACGACGACTCCCATGGG
AAGCATGCCCTCGTCTTCTCGCTCCTCTACTACGCCCGAGAACTCGCCGTACAATCGAGCCGTTTACATGAAGGA
TGCCTCGTACCGCGTCCTGTCGCCCACCAAGACGCTCATCTTCTCCTTTTCCATGACGCTCTTCACCACGTTTTA
CTGGAATGTCGCTGCCCTTTCTTCCATGAAGCTCGCCTGCCGCTTCTTCGTGCAGTTCTTCTTGGGAATCGACAG
CACCTACGATATTCTCGTCATCTTCGGCCTCGATCTCGCCTGCTCCATGGTCCTCCTCACCACCTTTGCCGTCCT
GGCTCTCAGCGCCGTCATCCTTTCCAAGAGGTTTCTCATCGGGAAATTCGAGCCGGGCGTCTATGACTGGGACAA
GTCGCCCATGTGTCAGCGCTGGCAGCTGCTAACGGCCATTGAAAAGATCATCCGCCGCTGCTACGTCGACAAGGG
AATCCTAAGCATGTTGACGGGCACGCACTGGCTCGTCCTCTACTACCGTGCCCTGGGCGTCAAGATCGGAAAGGA
CTGCTCGCTCTTCGCAAACGGCTATCCCAGTCTGCTCATCACTGCCGCCGATCTGGTTGAGATTGGCGACCGTGT
TGTTCTCGATGACGTCGGTCTCGTCTCTCATATGGATAGAAGGGGCAGCGTGCGTCTAGATCACATCAAGATCGG
TCACCGCTGCGTCTTACGCACGGGAAGCAACATCCTCTACGGCGCCGAGATGAGAGATGAGAGCTGTCTGCTGGA
GCACACGCTTGTTCTCCCCGGCGAGGTCGTCAAGGAGAAATGGACCATGCAGCGTCGTCCGGCCGAGCGCTTCTA
CGGTTCCCGCAAAGGGACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail