Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03855
Gene name
Locationscaffold_04:125956..131003
Strand-
Gene length (bp)5047
Transcript length (bp)4989
Coding sequence length (bp)4989
Protein length (aa) 1663

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.3E-09 141 399

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 864 886 22
2 907 929 22
3 955 972 17
4 1111 1133 22
5 1168 1190 22
6 1418 1440 22
7 1460 1482 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03855
MHVDWLSEGSDELARRISQLYRLPPATVSESSLFRNILTDASLSKGVLLASIPTCNNQPYRPLHIFYLIVTEVGG
SWPSFALFYHFLRLRRRLPETGHQDEAAWLVQSAESIVRESYGSLADFVAGADEAVLRTVRGDIFMTHRQLGRFV
DGFALPSLGSPESRIVVAVIIPDEPLMAAVCVAVATYYVVVPLNVEAELDQIKADLERVQANCVVTTPEVLQDGR
LVRMGAWLERQKMAIFTTEMDAEERGRIVVRDRHLRPLSAAVPGSLRRNGPADAAVLLFNKGIWGTRGLVTLTTH
GLIKEAIEAVEAWRLVPRDVCFNMAPVDDMGGLTRGVMAAIVSGGSVVCCSRTSPRLFWDALPELRLTWCLASLA
KLKLILSEAPFHPQTAWQNTLRLACRSDGFIPADMAALIEETFHCDIASADRSPVRPQLTLSHSAVGSLDERDDA
RYAEESDEEESEKYSSTTLTAYTTDWFSSGHDSHAKEKLDDYLDDDGYLRVMGASKEVIHSGKRAIDPQAVEKAI
MTASESPDSPIHNRVAAVLAFSMAHETQGEAVAVVVVPSPEVLRVDLRTLHDALRASPLDDARWPHSIVYMSRLP
MRRGKPLRARLGARLGLPELSDETPYAARHWEATCPPPDTSLMTPIEVLGCRVDVEAITATLAAVAPSRFRVHVE
ECPEASGYDVFLAPESASAAGMLPPGGAEHFRRLMNASLVAEGHAGLPGNLHILDDPLPLGPDGVPDRARLAEMQ
AELHRDMLPTPVRHAEDRVERAFAEVLGRGPYHAPLDREAGFYRIGGNSRKAKLLLAALRVDFNLPLPADLLTPP
RTGSVRAVAAFVEARMRDEQAAPRGHGCTETYSSTRPWLLILQLLPLVFLYPLLLTMGASFQMFILSKTRFWRTV
ELVGGRLANLLVSLMTTWITLQIIIPWFGIAAKWLIIGRYREGVYPMWGPYHTRWWMVQKMVMICGMGIFDISDR
GRILYHRLMGAKIGRDVHISDVTLGEWDLLDIRDGARLERCHCRPFAAEENSSMYLGRIVIGERASVGLMSVLAP
GTEVLPDTRIGANSSSWEQADSWSGPTPGPAGTWPDVEAGAEPAPPIPEPHWLLTLLLTMPIYLIGWFISMLPWL
VVLIGMLYQPPKRSTIPVRVIADYYQSSPAVAYNYLSDGSSVAFSPLLFFLFAVAVRAITRAVAGDLPTKSAEIR
SSLHAWRIALIRTLFPEKQLKALNDMLGHHNEARSGVLRMLGARVGRRVCWPTVGPVVRDYHLVDIGDDVTFGES
CFLQTYEDGDSGVISIGNGAVISDHVCIMPGVSVGERTTLGFGTLTRRGRHYQSGKAFIGCRAGDAARSHSVGGG
ILWPVPDGFGRLRHADSAETLVPSNTTTPMGSMPSSSRSSTTPENSPYNRAVYMKDASYRVLSPTKTLIFSFSMT
LFTTFYWNVAALSSMKLACRFFVQFFLGIDSTYDILVIFGLDLACSMVLLTTFAVLALSAVILSKRFLIGKFEPG
VYDWDKSPMCQRWQLLTAIEKIIRRCYVDKGILSMLTGTHWLVLYYRALGVKIGKDCSLFANGYPSLLITAADLV
EIGDRVVLDDVGLVSHMDRRGSVRLDHIKIGHRCVLRTGSNILYGAEMRDESCLLEHTLVLPGEVVKEKWTMQRR
PAERFYGSRKGT*
Coding >Ophcf2|03855
ATGCATGTTGATTGGCTATCCGAAGGCTCCGATGAGCTGGCGAGACGCATCTCGCAGCTCTACCGGTTGCCGCCT
GCGACGGTCAGCGAAAGCAGTCTCTTCCGCAATATCTTGACGGATGCTTCGCTCAGTAAGGGGGTGCTGCTAGCT
TCTATCCCGACTTGCAACAACCAACCTTACCGACCGCTTCACATTTTCTACCTGATTGTTACCGAGGTGGGCGGA
TCATGGCCCTCGTTTGCGCTCTTTTATCACTTTCTCAGGCTGCGGAGGCGGCTTCCGGAGACGGGACACCAGGAT
GAGGCGGCGTGGTTGGTTCAGAGTGCTGAGAGCATCGTTAGGGAGTCTTATGGCTCGCTGGCGGATTTCGTTGCT
GGGGCGGATGAGGCTGTTTTGAGGACTGTTAGGGGGGATATCTTTATGACGCATCGGCAGCTGGGAAGGTTTGTC
GATGGCTTTGCTCTTCCGTCGTTGGGGTCGCCTGAGAGTCGGATCGTCGTGGCTGTCATCATCCCCGATGAGCCG
CTGATGGCAGCCGTCTGCGTGGCGGTGGCGACGTACTACGTTGTCGTTCCGCTGAATGTGGAAGCGGAACTCGAT
CAGATCAAGGCGGATCTGGAGAGGGTACAGGCTAACTGTGTTGTCACGACGCCCGAGGTGCTTCAGGACGGCCGA
CTGGTACGGATGGGAGCCTGGCTTGAGAGACAGAAGATGGCCATCTTTACGACCGAGATGGACGCCGAGGAACGG
GGCCGGATCGTGGTCAGGGATCGGCATCTTCGACCTCTATCGGCTGCTGTTCCCGGTTCTCTGCGACGGAATGGA
CCGGCTGACGCGGCGGTCTTGCTGTTCAACAAGGGAATCTGGGGGACGAGGGGGTTGGTGACCCTCACGACGCAT
GGCTTGATAAAGGAGGCCATCGAAGCGGTTGAGGCCTGGAGACTCGTTCCCCGAGATGTGTGTTTCAACATGGCT
CCCGTCGACGACATGGGCGGTCTTACACGCGGAGTCATGGCCGCCATCGTTTCAGGAGGATCCGTCGTGTGCTGT
TCCAGGACGAGCCCTCGACTCTTCTGGGATGCGTTGCCGGAGCTGAGACTTACATGGTGTCTGGCTTCGTTGGCA
AAGTTGAAGCTCATCCTTTCTGAGGCACCCTTTCATCCGCAGACGGCGTGGCAGAATACTCTGCGGTTGGCGTGC
CGGTCCGATGGCTTCATCCCGGCTGATATGGCGGCCTTGATCGAGGAGACGTTTCACTGCGATATTGCCTCTGCG
GATCGTTCACCGGTACGACCGCAACTTACTCTCTCTCACTCCGCCGTCGGCTCCCTCGACGAAAGAGACGACGCG
CGATACGCAGAAGAATCGGACGAAGAAGAATCCGAAAAGTACTCTTCCACTACTCTGACGGCCTACACCACAGAC
TGGTTCAGCAGCGGTCACGACTCACACGCGAAGGAGAAGCTTGACGATTACCTCGACGACGATGGCTACCTTCGC
GTAATGGGCGCCTCTAAGGAAGTCATCCACAGCGGCAAGCGAGCCATCGACCCGCAAGCCGTGGAGAAAGCCATC
ATGACAGCCAGCGAATCACCCGACTCGCCCATTCACAACCGCGTTGCCGCCGTGCTGGCCTTTAGCATGGCTCAC
GAGACGCAGGGTGAGGCCGTGGCCGTTGTTGTCGTTCCCAGCCCGGAAGTCCTGCGTGTTGATCTCCGGACGTTG
CATGATGCGTTGAGGGCTTCGCCTCTCGACGATGCGAGGTGGCCGCATTCCATCGTCTATATGAGTCGCTTGCCT
ATGCGGCGGGGGAAACCGCTCAGAGCCCGGCTCGGTGCTCGTCTCGGTCTACCGGAGTTATCGGATGAGACGCCC
TACGCTGCTCGACACTGGGAAGCGACTTGTCCTCCACCCGACACCTCGTTGATGACGCCCATCGAGGTGCTGGGC
TGCCGCGTCGACGTCGAAGCCATCACCGCCACCCTCGCCGCCGTTGCCCCGAGCAGGTTCAGGGTACACGTGGAG
GAATGCCCCGAAGCGAGCGGATACGACGTCTTCCTCGCCCCGGAGTCGGCCTCCGCAGCCGGCATGCTCCCCCCG
GGCGGGGCCGAACACTTCCGCCGCCTGATGAACGCCTCGCTCGTGGCAGAGGGACACGCCGGATTACCGGGAAAC
CTCCACATCCTGGATGACCCGCTGCCCCTGGGGCCGGACGGGGTTCCGGACCGGGCCCGGCTGGCGGAGATGCAG
GCCGAGTTGCATCGCGATATGCTGCCGACGCCGGTGCGGCACGCCGAGGATCGGGTTGAGAGGGCCTTTGCAGAG
GTTCTTGGCAGGGGACCTTATCACGCTCCTCTCGATCGCGAGGCTGGTTTCTACCGGATCGGTGGTAACTCTCGA
AAGGCGAAACTGCTACTCGCTGCCCTCAGAGTCGACTTCAACCTCCCGCTTCCGGCAGATCTCCTGACGCCGCCG
AGGACGGGCTCCGTCCGGGCGGTAGCGGCCTTTGTCGAGGCCCGGATGCGAGACGAGCAGGCAGCTCCACGCGGA
CACGGCTGCACGGAAACCTACAGCTCGACACGACCGTGGTTGCTGATACTGCAACTGTTGCCTCTCGTATTCCTA
TACCCCCTCCTGCTGACCATGGGAGCATCCTTTCAAATGTTCATCCTCAGCAAGACGCGCTTCTGGCGGACGGTC
GAGCTGGTGGGCGGGAGGCTTGCCAACCTGCTCGTCTCGCTGATGACGACGTGGATAACGCTACAGATCATCATC
CCCTGGTTCGGAATCGCGGCCAAGTGGCTCATCATCGGCCGGTACCGCGAGGGCGTGTATCCGATGTGGGGGCCG
TATCATACGCGGTGGTGGATGGTGCAGAAGATGGTCATGATCTGCGGCATGGGCATCTTCGACATCAGCGACAGG
GGCCGCATCCTATACCACCGGCTGATGGGCGCCAAGATCGGCCGCGACGTCCACATCAGCGACGTGACTCTGGGC
GAGTGGGATCTTCTGGATATCCGGGACGGAGCCCGTCTGGAACGCTGTCACTGTCGACCCTTTGCCGCGGAGGAG
AACTCGTCCATGTATCTCGGTCGCATCGTCATCGGCGAGCGGGCTTCCGTCGGGCTCATGTCCGTCTTGGCGCCC
GGGACCGAGGTGCTCCCGGACACGCGCATCGGAGCAAACTCTTCTAGCTGGGAGCAGGCCGATTCGTGGTCCGGC
CCCACTCCCGGCCCGGCCGGCACGTGGCCCGACGTCGAGGCCGGAGCGGAGCCGGCGCCGCCTATCCCGGAGCCC
CACTGGTTGCTGACGCTGCTGCTGACGATGCCCATCTACCTGATCGGCTGGTTCATCTCGATGCTTCCCTGGCTG
GTGGTCCTCATCGGCATGCTGTACCAGCCGCCGAAACGGAGTACGATCCCGGTACGCGTCATCGCGGATTACTAC
CAGAGCAGCCCGGCGGTCGCGTACAACTATCTATCCGACGGCAGTAGCGTCGCCTTCTCCCCGCTGCTCTTCTTC
CTCTTCGCCGTCGCCGTCCGTGCCATCACCCGTGCCGTGGCCGGCGACCTACCCACCAAGTCGGCCGAGATCCGG
AGCTCGCTTCACGCGTGGCGAATCGCCCTCATCCGGACCCTCTTCCCCGAGAAGCAGCTCAAGGCTCTGAACGAT
ATGCTCGGTCACCATAACGAGGCTCGCTCCGGCGTCCTCCGGATGCTAGGAGCTCGTGTCGGTCGTCGCGTCTGC
TGGCCGACTGTCGGGCCGGTGGTGCGAGATTACCACCTCGTCGATATCGGCGACGACGTCACCTTTGGCGAGAGC
TGCTTCCTACAGACGTACGAGGACGGGGACTCGGGTGTCATCAGCATCGGGAACGGGGCCGTCATCTCCGATCAC
GTCTGCATCATGCCCGGAGTCTCCGTCGGCGAGCGAACGACGCTCGGTTTCGGCACTCTGACCCGCCGCGGACGC
CATTACCAGTCCGGCAAGGCCTTCATCGGCTGCCGAGCCGGAGACGCGGCTCGCTCTCACAGCGTCGGAGGCGGA
ATCCTTTGGCCGGTCCCGGATGGTTTCGGCCGGCTCCGTCACGCCGATAGCGCCGAGACGCTGGTGCCCTCCAAC
ACGACGACTCCCATGGGAAGCATGCCCTCGTCTTCTCGCTCCTCTACTACGCCCGAGAACTCGCCGTACAATCGA
GCCGTTTACATGAAGGATGCCTCGTACCGCGTCCTGTCGCCCACCAAGACGCTCATCTTCTCCTTTTCCATGACG
CTCTTCACCACGTTTTACTGGAATGTCGCTGCCCTTTCTTCCATGAAGCTCGCCTGCCGCTTCTTCGTGCAGTTC
TTCTTGGGAATCGACAGCACCTACGATATTCTCGTCATCTTCGGCCTCGATCTCGCCTGCTCCATGGTCCTCCTC
ACCACCTTTGCCGTCCTGGCTCTCAGCGCCGTCATCCTTTCCAAGAGGTTTCTCATCGGGAAATTCGAGCCGGGC
GTCTATGACTGGGACAAGTCGCCCATGTGTCAGCGCTGGCAGCTGCTAACGGCCATTGAAAAGATCATCCGCCGC
TGCTACGTCGACAAGGGAATCCTAAGCATGTTGACGGGCACGCACTGGCTCGTCCTCTACTACCGTGCCCTGGGC
GTCAAGATCGGAAAGGACTGCTCGCTCTTCGCAAACGGCTATCCCAGTCTGCTCATCACTGCCGCCGATCTGGTT
GAGATTGGCGACCGTGTTGTTCTCGATGACGTCGGTCTCGTCTCTCATATGGATAGAAGGGGCAGCGTGCGTCTA
GATCACATCAAGATCGGTCACCGCTGCGTCTTACGCACGGGAAGCAACATCCTCTACGGCGCCGAGATGAGAGAT
GAGAGCTGTCTGCTGGAGCACACGCTTGTTCTCCCCGGCGAGGTCGTCAAGGAGAAATGGACCATGCAGCGTCGT
CCGGCCGAGCGCTTCTACGGTTCCCGCAAAGGGACGTAG
Transcript >Ophcf2|03855
ATGCATGTTGATTGGCTATCCGAAGGCTCCGATGAGCTGGCGAGACGCATCTCGCAGCTCTACCGGTTGCCGCCT
GCGACGGTCAGCGAAAGCAGTCTCTTCCGCAATATCTTGACGGATGCTTCGCTCAGTAAGGGGGTGCTGCTAGCT
TCTATCCCGACTTGCAACAACCAACCTTACCGACCGCTTCACATTTTCTACCTGATTGTTACCGAGGTGGGCGGA
TCATGGCCCTCGTTTGCGCTCTTTTATCACTTTCTCAGGCTGCGGAGGCGGCTTCCGGAGACGGGACACCAGGAT
GAGGCGGCGTGGTTGGTTCAGAGTGCTGAGAGCATCGTTAGGGAGTCTTATGGCTCGCTGGCGGATTTCGTTGCT
GGGGCGGATGAGGCTGTTTTGAGGACTGTTAGGGGGGATATCTTTATGACGCATCGGCAGCTGGGAAGGTTTGTC
GATGGCTTTGCTCTTCCGTCGTTGGGGTCGCCTGAGAGTCGGATCGTCGTGGCTGTCATCATCCCCGATGAGCCG
CTGATGGCAGCCGTCTGCGTGGCGGTGGCGACGTACTACGTTGTCGTTCCGCTGAATGTGGAAGCGGAACTCGAT
CAGATCAAGGCGGATCTGGAGAGGGTACAGGCTAACTGTGTTGTCACGACGCCCGAGGTGCTTCAGGACGGCCGA
CTGGTACGGATGGGAGCCTGGCTTGAGAGACAGAAGATGGCCATCTTTACGACCGAGATGGACGCCGAGGAACGG
GGCCGGATCGTGGTCAGGGATCGGCATCTTCGACCTCTATCGGCTGCTGTTCCCGGTTCTCTGCGACGGAATGGA
CCGGCTGACGCGGCGGTCTTGCTGTTCAACAAGGGAATCTGGGGGACGAGGGGGTTGGTGACCCTCACGACGCAT
GGCTTGATAAAGGAGGCCATCGAAGCGGTTGAGGCCTGGAGACTCGTTCCCCGAGATGTGTGTTTCAACATGGCT
CCCGTCGACGACATGGGCGGTCTTACACGCGGAGTCATGGCCGCCATCGTTTCAGGAGGATCCGTCGTGTGCTGT
TCCAGGACGAGCCCTCGACTCTTCTGGGATGCGTTGCCGGAGCTGAGACTTACATGGTGTCTGGCTTCGTTGGCA
AAGTTGAAGCTCATCCTTTCTGAGGCACCCTTTCATCCGCAGACGGCGTGGCAGAATACTCTGCGGTTGGCGTGC
CGGTCCGATGGCTTCATCCCGGCTGATATGGCGGCCTTGATCGAGGAGACGTTTCACTGCGATATTGCCTCTGCG
GATCGTTCACCGGTACGACCGCAACTTACTCTCTCTCACTCCGCCGTCGGCTCCCTCGACGAAAGAGACGACGCG
CGATACGCAGAAGAATCGGACGAAGAAGAATCCGAAAAGTACTCTTCCACTACTCTGACGGCCTACACCACAGAC
TGGTTCAGCAGCGGTCACGACTCACACGCGAAGGAGAAGCTTGACGATTACCTCGACGACGATGGCTACCTTCGC
GTAATGGGCGCCTCTAAGGAAGTCATCCACAGCGGCAAGCGAGCCATCGACCCGCAAGCCGTGGAGAAAGCCATC
ATGACAGCCAGCGAATCACCCGACTCGCCCATTCACAACCGCGTTGCCGCCGTGCTGGCCTTTAGCATGGCTCAC
GAGACGCAGGGTGAGGCCGTGGCCGTTGTTGTCGTTCCCAGCCCGGAAGTCCTGCGTGTTGATCTCCGGACGTTG
CATGATGCGTTGAGGGCTTCGCCTCTCGACGATGCGAGGTGGCCGCATTCCATCGTCTATATGAGTCGCTTGCCT
ATGCGGCGGGGGAAACCGCTCAGAGCCCGGCTCGGTGCTCGTCTCGGTCTACCGGAGTTATCGGATGAGACGCCC
TACGCTGCTCGACACTGGGAAGCGACTTGTCCTCCACCCGACACCTCGTTGATGACGCCCATCGAGGTGCTGGGC
TGCCGCGTCGACGTCGAAGCCATCACCGCCACCCTCGCCGCCGTTGCCCCGAGCAGGTTCAGGGTACACGTGGAG
GAATGCCCCGAAGCGAGCGGATACGACGTCTTCCTCGCCCCGGAGTCGGCCTCCGCAGCCGGCATGCTCCCCCCG
GGCGGGGCCGAACACTTCCGCCGCCTGATGAACGCCTCGCTCGTGGCAGAGGGACACGCCGGATTACCGGGAAAC
CTCCACATCCTGGATGACCCGCTGCCCCTGGGGCCGGACGGGGTTCCGGACCGGGCCCGGCTGGCGGAGATGCAG
GCCGAGTTGCATCGCGATATGCTGCCGACGCCGGTGCGGCACGCCGAGGATCGGGTTGAGAGGGCCTTTGCAGAG
GTTCTTGGCAGGGGACCTTATCACGCTCCTCTCGATCGCGAGGCTGGTTTCTACCGGATCGGTGGTAACTCTCGA
AAGGCGAAACTGCTACTCGCTGCCCTCAGAGTCGACTTCAACCTCCCGCTTCCGGCAGATCTCCTGACGCCGCCG
AGGACGGGCTCCGTCCGGGCGGTAGCGGCCTTTGTCGAGGCCCGGATGCGAGACGAGCAGGCAGCTCCACGCGGA
CACGGCTGCACGGAAACCTACAGCTCGACACGACCGTGGTTGCTGATACTGCAACTGTTGCCTCTCGTATTCCTA
TACCCCCTCCTGCTGACCATGGGAGCATCCTTTCAAATGTTCATCCTCAGCAAGACGCGCTTCTGGCGGACGGTC
GAGCTGGTGGGCGGGAGGCTTGCCAACCTGCTCGTCTCGCTGATGACGACGTGGATAACGCTACAGATCATCATC
CCCTGGTTCGGAATCGCGGCCAAGTGGCTCATCATCGGCCGGTACCGCGAGGGCGTGTATCCGATGTGGGGGCCG
TATCATACGCGGTGGTGGATGGTGCAGAAGATGGTCATGATCTGCGGCATGGGCATCTTCGACATCAGCGACAGG
GGCCGCATCCTATACCACCGGCTGATGGGCGCCAAGATCGGCCGCGACGTCCACATCAGCGACGTGACTCTGGGC
GAGTGGGATCTTCTGGATATCCGGGACGGAGCCCGTCTGGAACGCTGTCACTGTCGACCCTTTGCCGCGGAGGAG
AACTCGTCCATGTATCTCGGTCGCATCGTCATCGGCGAGCGGGCTTCCGTCGGGCTCATGTCCGTCTTGGCGCCC
GGGACCGAGGTGCTCCCGGACACGCGCATCGGAGCAAACTCTTCTAGCTGGGAGCAGGCCGATTCGTGGTCCGGC
CCCACTCCCGGCCCGGCCGGCACGTGGCCCGACGTCGAGGCCGGAGCGGAGCCGGCGCCGCCTATCCCGGAGCCC
CACTGGTTGCTGACGCTGCTGCTGACGATGCCCATCTACCTGATCGGCTGGTTCATCTCGATGCTTCCCTGGCTG
GTGGTCCTCATCGGCATGCTGTACCAGCCGCCGAAACGGAGTACGATCCCGGTACGCGTCATCGCGGATTACTAC
CAGAGCAGCCCGGCGGTCGCGTACAACTATCTATCCGACGGCAGTAGCGTCGCCTTCTCCCCGCTGCTCTTCTTC
CTCTTCGCCGTCGCCGTCCGTGCCATCACCCGTGCCGTGGCCGGCGACCTACCCACCAAGTCGGCCGAGATCCGG
AGCTCGCTTCACGCGTGGCGAATCGCCCTCATCCGGACCCTCTTCCCCGAGAAGCAGCTCAAGGCTCTGAACGAT
ATGCTCGGTCACCATAACGAGGCTCGCTCCGGCGTCCTCCGGATGCTAGGAGCTCGTGTCGGTCGTCGCGTCTGC
TGGCCGACTGTCGGGCCGGTGGTGCGAGATTACCACCTCGTCGATATCGGCGACGACGTCACCTTTGGCGAGAGC
TGCTTCCTACAGACGTACGAGGACGGGGACTCGGGTGTCATCAGCATCGGGAACGGGGCCGTCATCTCCGATCAC
GTCTGCATCATGCCCGGAGTCTCCGTCGGCGAGCGAACGACGCTCGGTTTCGGCACTCTGACCCGCCGCGGACGC
CATTACCAGTCCGGCAAGGCCTTCATCGGCTGCCGAGCCGGAGACGCGGCTCGCTCTCACAGCGTCGGAGGCGGA
ATCCTTTGGCCGGTCCCGGATGGTTTCGGCCGGCTCCGTCACGCCGATAGCGCCGAGACGCTGGTGCCCTCCAAC
ACGACGACTCCCATGGGAAGCATGCCCTCGTCTTCTCGCTCCTCTACTACGCCCGAGAACTCGCCGTACAATCGA
GCCGTTTACATGAAGGATGCCTCGTACCGCGTCCTGTCGCCCACCAAGACGCTCATCTTCTCCTTTTCCATGACG
CTCTTCACCACGTTTTACTGGAATGTCGCTGCCCTTTCTTCCATGAAGCTCGCCTGCCGCTTCTTCGTGCAGTTC
TTCTTGGGAATCGACAGCACCTACGATATTCTCGTCATCTTCGGCCTCGATCTCGCCTGCTCCATGGTCCTCCTC
ACCACCTTTGCCGTCCTGGCTCTCAGCGCCGTCATCCTTTCCAAGAGGTTTCTCATCGGGAAATTCGAGCCGGGC
GTCTATGACTGGGACAAGTCGCCCATGTGTCAGCGCTGGCAGCTGCTAACGGCCATTGAAAAGATCATCCGCCGC
TGCTACGTCGACAAGGGAATCCTAAGCATGTTGACGGGCACGCACTGGCTCGTCCTCTACTACCGTGCCCTGGGC
GTCAAGATCGGAAAGGACTGCTCGCTCTTCGCAAACGGCTATCCCAGTCTGCTCATCACTGCCGCCGATCTGGTT
GAGATTGGCGACCGTGTTGTTCTCGATGACGTCGGTCTCGTCTCTCATATGGATAGAAGGGGCAGCGTGCGTCTA
GATCACATCAAGATCGGTCACCGCTGCGTCTTACGCACGGGAAGCAACATCCTCTACGGCGCCGAGATGAGAGAT
GAGAGCTGTCTGCTGGAGCACACGCTTGTTCTCCCCGGCGAGGTCGTCAAGGAGAAATGGACCATGCAGCGTCGT
CCGGCCGAGCGCTTCTACGGTTCCCGCAAAGGGACGTAG
Gene >Ophcf2|03855
ATGCATGTTGATTGGCTATCCGAAGGCTCCGATGAGCTGGCGAGACGCATCTCGCAGCTCTACCGGTTGCCGCCT
GCGACGGTCAGCGAAAGCAGTCTCTTCCGCAATATCTTGACGGATGCTTCGCTCAGTAAGGGGGTGCTGCTAGCT
TCTATCCCGACTTGCAACAACCAACCTTACCGACCGCTTCACATTTTCTACCTGATTGTTACCGAGGTGGGCGGA
TCATGGCCCTCGTTTGCGCTCTTTTATCACTTTCTCAGGCTGCGGAGGCGGCTTCCGGAGACGGGACACCAGGAT
GAGGCGGCGTGGTTGGTTCAGAGTGCTGAGAGCATCGTTAGGGAGTCTTATGGCTCGCTGGCGGATTTCGTTGCT
GGGGCGGATGAGGCTGTTTTGAGGACTGTTAGGGGGGATATCTTTATGACGCATCGGCAGCTGGGAAGGTTTGTC
GATGGCTTTGCTCTTCCGTCGTTGGGGTCGCCTGAGAGTCGGATCGTCGTGGCTGTCATCATCCCCGATGAGCCG
CTGATGGCAGCCGTCTGCGTGGCGGTGGCGACGTACTACGTTGTCGTTCCGCTGAATGTGGAAGCGGAACTCGAT
CAGATCAAGGCGGATCTGGAGAGGGTACAGGCTAACTGTGTTGTCACGACGCCCGAGGTGCTTCAGGACGGCCGA
CTGGTACGGATGGGAGCCTGGCTTGAGAGACAGAAGATGGCCATCTTTACGACCGAGATGGACGCCGAGGAACGG
GGCCGGATCGTGGTCAGGGATCGGCATCTTCGACCTCTATCGGCTGCTGTTCCCGGTTCTCTGCGACGGAATGGA
CCGGCTGACGCGGCGGTCTTGCTGTTCAACAAGGGAATCTGGGGGACGAGGGGGTTGGTGACCCTCACGACGCAT
GGCTTGATAAAGGAGGCCATCGAAGCGGTTGAGGCCTGGAGACTCGTTCCCCGAGATGTGTGTTTCAACATGGCT
CCCGTCGACGACATGGGCGGTCTTACACGCGGAGTCATGGCCGCCATCGTTTCAGGAGGATCCGTCGTGTGCTGT
TCCAGGACGAGCCCTCGACTCTTCTGGGATGCGTTGCCGGAGCTGAGACTTACATGGTGTCTGGCTTCGTTGGCA
AAGTTGAAGCTCATCCTTTCTGAGGCACCCTTTCATCCGCAGACGGCGTGGCAGAATACTCTGCGGTTGGCGTGC
CGGTCCGATGGCTTCATCCCGGCTGATATGGCGGCCTTGATCGAGGAGACGTTTCACTGCGATATTGCCTCTGCG
GATCGTTCACCGGTGTAAGTCTTGAGGATATCGTCGGTTTGACTTGGTGATTGAGTTGACTAACGGTGACAGACG
ACCGCAACTTACTCTCTCTCACTCCGCCGTCGGCTCCCTCGACGAAAGAGACGACGCGCGATACGCAGAAGAATC
GGACGAAGAAGAATCCGAAAAGTACTCTTCCACTACTCTGACGGCCTACACCACAGACTGGTTCAGCAGCGGTCA
CGACTCACACGCGAAGGAGAAGCTTGACGATTACCTCGACGACGATGGCTACCTTCGCGTAATGGGCGCCTCTAA
GGAAGTCATCCACAGCGGCAAGCGAGCCATCGACCCGCAAGCCGTGGAGAAAGCCATCATGACAGCCAGCGAATC
ACCCGACTCGCCCATTCACAACCGCGTTGCCGCCGTGCTGGCCTTTAGCATGGCTCACGAGACGCAGGGTGAGGC
CGTGGCCGTTGTTGTCGTTCCCAGCCCGGAAGTCCTGCGTGTTGATCTCCGGACGTTGCATGATGCGTTGAGGGC
TTCGCCTCTCGACGATGCGAGGTGGCCGCATTCCATCGTCTATATGAGTCGCTTGCCTATGCGGCGGGGGAAACC
GCTCAGAGCCCGGCTCGGTGCTCGTCTCGGTCTACCGGAGTTATCGGATGAGACGCCCTACGCTGCTCGACACTG
GGAAGCGACTTGTCCTCCACCCGACACCTCGTTGATGACGCCCATCGAGGTGCTGGGCTGCCGCGTCGACGTCGA
AGCCATCACCGCCACCCTCGCCGCCGTTGCCCCGAGCAGGTTCAGGGTACACGTGGAGGAATGCCCCGAAGCGAG
CGGATACGACGTCTTCCTCGCCCCGGAGTCGGCCTCCGCAGCCGGCATGCTCCCCCCGGGCGGGGCCGAACACTT
CCGCCGCCTGATGAACGCCTCGCTCGTGGCAGAGGGACACGCCGGATTACCGGGAAACCTCCACATCCTGGATGA
CCCGCTGCCCCTGGGGCCGGACGGGGTTCCGGACCGGGCCCGGCTGGCGGAGATGCAGGCCGAGTTGCATCGCGA
TATGCTGCCGACGCCGGTGCGGCACGCCGAGGATCGGGTTGAGAGGGCCTTTGCAGAGGTTCTTGGCAGGGGACC
TTATCACGCTCCTCTCGATCGCGAGGCTGGTTTCTACCGGATCGGTGGTAACTCTCGAAAGGCGAAACTGCTACT
CGCTGCCCTCAGAGTCGACTTCAACCTCCCGCTTCCGGCAGATCTCCTGACGCCGCCGAGGACGGGCTCCGTCCG
GGCGGTAGCGGCCTTTGTCGAGGCCCGGATGCGAGACGAGCAGGCAGCTCCACGCGGACACGGCTGCACGGAAAC
CTACAGCTCGACACGACCGTGGTTGCTGATACTGCAACTGTTGCCTCTCGTATTCCTATACCCCCTCCTGCTGAC
CATGGGAGCATCCTTTCAAATGTTCATCCTCAGCAAGACGCGCTTCTGGCGGACGGTCGAGCTGGTGGGCGGGAG
GCTTGCCAACCTGCTCGTCTCGCTGATGACGACGTGGATAACGCTACAGATCATCATCCCCTGGTTCGGAATCGC
GGCCAAGTGGCTCATCATCGGCCGGTACCGCGAGGGCGTGTATCCGATGTGGGGGCCGTATCATACGCGGTGGTG
GATGGTGCAGAAGATGGTCATGATCTGCGGCATGGGCATCTTCGACATCAGCGACAGGGGCCGCATCCTATACCA
CCGGCTGATGGGCGCCAAGATCGGCCGCGACGTCCACATCAGCGACGTGACTCTGGGCGAGTGGGATCTTCTGGA
TATCCGGGACGGAGCCCGTCTGGAACGCTGTCACTGTCGACCCTTTGCCGCGGAGGAGAACTCGTCCATGTATCT
CGGTCGCATCGTCATCGGCGAGCGGGCTTCCGTCGGGCTCATGTCCGTCTTGGCGCCCGGGACCGAGGTGCTCCC
GGACACGCGCATCGGAGCAAACTCTTCTAGCTGGGAGCAGGCCGATTCGTGGTCCGGCCCCACTCCCGGCCCGGC
CGGCACGTGGCCCGACGTCGAGGCCGGAGCGGAGCCGGCGCCGCCTATCCCGGAGCCCCACTGGTTGCTGACGCT
GCTGCTGACGATGCCCATCTACCTGATCGGCTGGTTCATCTCGATGCTTCCCTGGCTGGTGGTCCTCATCGGCAT
GCTGTACCAGCCGCCGAAACGGAGTACGATCCCGGTACGCGTCATCGCGGATTACTACCAGAGCAGCCCGGCGGT
CGCGTACAACTATCTATCCGACGGCAGTAGCGTCGCCTTCTCCCCGCTGCTCTTCTTCCTCTTCGCCGTCGCCGT
CCGTGCCATCACCCGTGCCGTGGCCGGCGACCTACCCACCAAGTCGGCCGAGATCCGGAGCTCGCTTCACGCGTG
GCGAATCGCCCTCATCCGGACCCTCTTCCCCGAGAAGCAGCTCAAGGCTCTGAACGATATGCTCGGTCACCATAA
CGAGGCTCGCTCCGGCGTCCTCCGGATGCTAGGAGCTCGTGTCGGTCGTCGCGTCTGCTGGCCGACTGTCGGGCC
GGTGGTGCGAGATTACCACCTCGTCGATATCGGCGACGACGTCACCTTTGGCGAGAGCTGCTTCCTACAGACGTA
CGAGGACGGGGACTCGGGTGTCATCAGCATCGGGAACGGGGCCGTCATCTCCGATCACGTCTGCATCATGCCCGG
AGTCTCCGTCGGCGAGCGAACGACGCTCGGTTTCGGCACTCTGACCCGCCGCGGACGCCATTACCAGTCCGGCAA
GGCCTTCATCGGCTGCCGAGCCGGAGACGCGGCTCGCTCTCACAGCGTCGGAGGCGGAATCCTTTGGCCGGTCCC
GGATGGTTTCGGCCGGCTCCGTCACGCCGATAGCGCCGAGACGCTGGTGCCCTCCAACACGACGACTCCCATGGG
AAGCATGCCCTCGTCTTCTCGCTCCTCTACTACGCCCGAGAACTCGCCGTACAATCGAGCCGTTTACATGAAGGA
TGCCTCGTACCGCGTCCTGTCGCCCACCAAGACGCTCATCTTCTCCTTTTCCATGACGCTCTTCACCACGTTTTA
CTGGAATGTCGCTGCCCTTTCTTCCATGAAGCTCGCCTGCCGCTTCTTCGTGCAGTTCTTCTTGGGAATCGACAG
CACCTACGATATTCTCGTCATCTTCGGCCTCGATCTCGCCTGCTCCATGGTCCTCCTCACCACCTTTGCCGTCCT
GGCTCTCAGCGCCGTCATCCTTTCCAAGAGGTTTCTCATCGGGAAATTCGAGCCGGGCGTCTATGACTGGGACAA
GTCGCCCATGTGTCAGCGCTGGCAGCTGCTAACGGCCATTGAAAAGATCATCCGCCGCTGCTACGTCGACAAGGG
AATCCTAAGCATGTTGACGGGCACGCACTGGCTCGTCCTCTACTACCGTGCCCTGGGCGTCAAGATCGGAAAGGA
CTGCTCGCTCTTCGCAAACGGCTATCCCAGTCTGCTCATCACTGCCGCCGATCTGGTTGAGATTGGCGACCGTGT
TGTTCTCGATGACGTCGGTCTCGTCTCTCATATGGATAGAAGGGGCAGCGTGCGTCTAGATCACATCAAGATCGG
TCACCGCTGCGTCTTACGCACGGGAAGCAACATCCTCTACGGCGCCGAGATGAGAGATGAGAGCTGTCTGCTGGA
GCACACGCTTGTTCTCCCCGGCGAGGTCGTCAAGGAGAAATGGACCATGCAGCGTCGTCCGGCCGAGCGCTTCTA
CGGTTCCCGCAAAGGGACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail