Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03850
Gene name
Locationscaffold_04:105786..107280
Strand-
Gene length (bp)1494
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 1.9E-111 15 480

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 71 93 22
3 105 124 19
4 129 151 22
5 195 217 22
6 227 249 22
7 288 310 22
8 320 342 22
9 354 371 17
10 386 408 22
11 421 443 22
12 453 471 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03850
MAAQHHHHHAPRPTTSPRELRAWYLYYVGANGLALFNLAPALLQAILTQAASSTPSQRLNLNGRPHDVDSIILLA
NGASFAAQAVLLLVIGAYADFGAGTGRMLLLLLWSLVGYGVGFGWLAVRHQSRWVLAIVLYAVGLVAYQLTLTYW
TAALPGLARDAPSLRTGASEGAPINDDDLLRKDELERSRISNMAFWWQSVGEVAMLAVVIAVLAALARGRALPDP
SASLAALVAGVTACWLLLSIPWFVLEQRRPGVSVPPGQTVFGAGLRRLVDAARHMKQLRQSLIYLAGYFLLGDAL
NTTVTVVSTLQNRLVGFDPLTLSALLMAGIAAQAVGIAGFWLVQRRFALRAKTMFCAVCVAIVLLDVWGMVGNWT
DRFGFRNVWELWLYQVLYGLLVCPWYSYSQIVISSVTPRGHEFLFFSVFNVVGKASSFIGPFISSAIIDSSGSSS
APFYFLFALSFVSALGLWAFLDLEESAAEQAAFLARKQQADVGPAYG*
Coding >Ophcf2|03850
ATGGCCGCTCAACACCATCACCACCACGCCCCGCGGCCAACAACATCCCCCAGGGAACTCCGCGCCTGGTACCTC
TACTACGTAGGCGCCAACGGCCTCGCCCTCTTCAATCTCGCCCCGGCCCTCCTCCAAGCCATCCTCACCCAAGCC
GCCTCGTCAACCCCCTCCCAGCGCCTCAATCTCAACGGCCGACCCCATGACGTCGACAGCATCATCCTCCTCGCA
AACGGCGCCTCCTTCGCCGCCCAGGCCGTCCTCCTGCTCGTCATCGGCGCCTACGCAGACTTCGGAGCGGGGACG
GGACGCATGCTCCTGCTACTGCTGTGGTCGCTCGTCGGCTACGGGGTCGGCTTTGGTTGGCTCGCCGTTCGTCAT
CAGAGCAGATGGGTTCTCGCCATCGTGCTGTATGCCGTTGGTCTCGTCGCCTATCAGCTTACCTTGACGTATTGG
ACTGCCGCTCTACCTGGTCTGGCTCGGGATGCACCGTCGCTGAGAACGGGAGCCAGCGAGGGAGCGCCCATCAAC
GATGACGACCTCTTGCGAAAAGACGAGCTGGAGCGCAGCAGAATCAGCAACATGGCCTTTTGGTGGCAATCGGTC
GGTGAAGTGGCAATGCTAGCCGTCGTCATCGCCGTCCTCGCAGCCCTCGCCCGCGGTCGCGCCCTTCCGGATCCA
TCCGCCAGTCTAGCGGCCCTCGTCGCCGGTGTAACGGCCTGCTGGCTCCTCCTTTCCATCCCCTGGTTCGTCCTC
GAGCAGCGCCGTCCGGGAGTCTCCGTCCCTCCGGGCCAGACCGTCTTCGGCGCCGGGCTTCGCCGTCTGGTGGAC
GCGGCGCGACACATGAAGCAGCTGCGGCAGAGTCTCATCTACCTGGCCGGGTATTTCCTTCTCGGAGATGCGCTC
AACACGACGGTGACGGTCGTTTCGACGCTTCAGAATCGACTGGTCGGCTTCGATCCGCTTACGCTGTCCGCTCTG
CTCATGGCTGGCATCGCCGCCCAGGCCGTCGGCATCGCCGGCTTCTGGCTCGTCCAGAGACGATTCGCGCTGAGG
GCAAAGACCATGTTCTGCGCCGTCTGCGTCGCCATCGTCCTCCTCGACGTCTGGGGCATGGTCGGTAACTGGACG
GATCGCTTCGGCTTCCGTAACGTCTGGGAGCTGTGGCTGTACCAAGTGCTGTACGGACTGCTGGTGTGTCCGTGG
TACAGCTATTCGCAGATCGTCATCAGCTCCGTTACTCCCCGCGGCCACGAATTTCTCTTCTTCTCCGTCTTCAAC
GTCGTCGGCAAGGCATCGAGCTTCATCGGACCCTTCATCAGCAGCGCCATCATCGACTCGTCCGGCAGCTCCAGC
GCGCCTTTTTACTTTCTCTTCGCCCTGAGCTTCGTCAGTGCCCTCGGTCTCTGGGCCTTTTTGGATTTGGAGGAG
AGTGCGGCTGAGCAGGCTGCCTTCTTGGCCCGCAAGCAACAGGCCGACGTGGGGCCTGCATACGGATAG
Transcript >Ophcf2|03850
ATGGCCGCTCAACACCATCACCACCACGCCCCGCGGCCAACAACATCCCCCAGGGAACTCCGCGCCTGGTACCTC
TACTACGTAGGCGCCAACGGCCTCGCCCTCTTCAATCTCGCCCCGGCCCTCCTCCAAGCCATCCTCACCCAAGCC
GCCTCGTCAACCCCCTCCCAGCGCCTCAATCTCAACGGCCGACCCCATGACGTCGACAGCATCATCCTCCTCGCA
AACGGCGCCTCCTTCGCCGCCCAGGCCGTCCTCCTGCTCGTCATCGGCGCCTACGCAGACTTCGGAGCGGGGACG
GGACGCATGCTCCTGCTACTGCTGTGGTCGCTCGTCGGCTACGGGGTCGGCTTTGGTTGGCTCGCCGTTCGTCAT
CAGAGCAGATGGGTTCTCGCCATCGTGCTGTATGCCGTTGGTCTCGTCGCCTATCAGCTTACCTTGACGTATTGG
ACTGCCGCTCTACCTGGTCTGGCTCGGGATGCACCGTCGCTGAGAACGGGAGCCAGCGAGGGAGCGCCCATCAAC
GATGACGACCTCTTGCGAAAAGACGAGCTGGAGCGCAGCAGAATCAGCAACATGGCCTTTTGGTGGCAATCGGTC
GGTGAAGTGGCAATGCTAGCCGTCGTCATCGCCGTCCTCGCAGCCCTCGCCCGCGGTCGCGCCCTTCCGGATCCA
TCCGCCAGTCTAGCGGCCCTCGTCGCCGGTGTAACGGCCTGCTGGCTCCTCCTTTCCATCCCCTGGTTCGTCCTC
GAGCAGCGCCGTCCGGGAGTCTCCGTCCCTCCGGGCCAGACCGTCTTCGGCGCCGGGCTTCGCCGTCTGGTGGAC
GCGGCGCGACACATGAAGCAGCTGCGGCAGAGTCTCATCTACCTGGCCGGGTATTTCCTTCTCGGAGATGCGCTC
AACACGACGGTGACGGTCGTTTCGACGCTTCAGAATCGACTGGTCGGCTTCGATCCGCTTACGCTGTCCGCTCTG
CTCATGGCTGGCATCGCCGCCCAGGCCGTCGGCATCGCCGGCTTCTGGCTCGTCCAGAGACGATTCGCGCTGAGG
GCAAAGACCATGTTCTGCGCCGTCTGCGTCGCCATCGTCCTCCTCGACGTCTGGGGCATGGTCGGTAACTGGACG
GATCGCTTCGGCTTCCGTAACGTCTGGGAGCTGTGGCTGTACCAAGTGCTGTACGGACTGCTGGTGTGTCCGTGG
TACAGCTATTCGCAGATCGTCATCAGCTCCGTTACTCCCCGCGGCCACGAATTTCTCTTCTTCTCCGTCTTCAAC
GTCGTCGGCAAGGCATCGAGCTTCATCGGACCCTTCATCAGCAGCGCCATCATCGACTCGTCCGGCAGCTCCAGC
GCGCCTTTTTACTTTCTCTTCGCCCTGAGCTTCGTCAGTGCCCTCGGTCTCTGGGCCTTTTTGGATTTGGAGGAG
AGTGCGGCTGAGCAGGCTGCCTTCTTGGCCCGCAAGCAACAGGCCGACGTGGGGCCTGCATACGGATAG
Gene >Ophcf2|03850
ATGGCCGCTCAACACCATCACCACCACGCCCCGCGGCCAACAACATCCCCCAGGGAACTCCGCGCCTGGTACCTC
TACTACGTAGGCGCCAACGGCCTCGCCCTCTTCAATCTCGCCCCGGCCCTCCTCCAAGCCATCCTCACCCAAGCC
GCCTCGTCAACCCCCTCCCAGCGCCTCAATCTCAACGGCCGACCCCATGACGTCGACAGCATCATCCTCCTCGCA
AACGGCGCCTCCTTCGCCGCCCAGGCCGTCCTCCTGCTCGTCATCGGCGCCTACGCAGACTTCGGAGCGGGGACG
GGACGCATGCTCCTGCTACTGCTGTGGTCGCTCGTCGGCTACGGGGTCGGCTTTGGTTGGCTCGCCGTTCGTCAT
CAGAGCAGATGGGTTCTCGCCATCGTGCTGTATGCCGTTGGTCTCGTCGCCTATCAGCTTACCTTGACGTATTGG
ACTGCCGCTCTACCTGGTCTGGCTCGGGATGCACCGTCGCTGAGAACGGGAGCCAGCGAGGGAGCGCCCATCAAC
GATGACGACCTCTTGCGAAAAGACGAGCTGGAGCGCAGCAGAATCAGCAACATGGCCTTTTGGTGGCAATCGGTC
GGTGAAGTGGCAATGCTAGCCGTCGTCATCGCCGTCCTCGCAGCCCTCGCCCGCGGTCGCGCCCTTCCGGATCCA
TCCGCCAGTCTAGCGGCCCTCGTCGCCGGTGTAACGGCCTGCTGGCTCCTCCTTTCCATCCCCTGGTTCGTCCTC
GAGCAGCGCCGTCCGGGAGTCTCCGTCCCTCCGGGCCAGACCGTCTTCGGCGCCGGGCTTCGCCGTCTGGTGGAC
GCGGCGCGACACATGAAGCAGCTGCGGCAGAGTCTCATCTACCTGGCCGGGTATTTCCTTCTCGGAGATGCGCTC
AACACGACGGTGACGGTCGTTTCGACGCTTCAGAATCGACTGGTCGGCTTCGATCCGCTTACGCTGTCCGCTCTG
CTCATGGCTGGCATCGCCGCCCAGGCCGTCGGCATCGCCGGCTTCTGGCTCGTCCAGAGACGATTCGCGCTGAGG
GCAAAGACCATGTTCTGCGCCGTCTGCGTCGCCATCGTCCTCCTCGACGTCTGGGGCATGGTCGGTAACTGGACG
GATCGCTTCGGCTTCCGTAACGTCTGGGAGCTGTGGCTGTACCAAGTGCTGTACGGACTGCTGGTGTGTCCGTGG
TACAGCTATTCGCAGATCGTCATCAGCTCCGTTACTCCCCGCGGCCACGAATTTCTCTTCTTCTCCGTCTTCAAC
GTCGTCGGCAAGGCATCGAGCTTCATCGGACCCTTCATCAGCAGCGCCATCATCGACTCGTCCGGCAGCTCCAGC
GCGCCTTTTTACTTTCTCTTCGCCCTGAGCTTCGTCAGTGCCCTCGGTCTCTGGGCCTTTTTGGATTTGGAGGAG
AGTGCGGCTGAGCAGGCTGCCTTCTTGGCCCGCAAGCAACAGGCCGACGTGGGGCCTGCATACGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail