Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03842
Gene name
Locationscaffold_04:84544..88292
Strand-
Gene length (bp)3748
Transcript length (bp)2526
Coding sequence length (bp)2526
Protein length (aa) 842

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 8.6E-75 365 737
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 4.2E-16 746 821
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 2.6E-13 108 190

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1859 0.1072 0.3442 0.1769 0.0934 0.0171 0.5071 0.1892 0.8779 0.0386

SignalP

SignalP signal predicted Location Score
Yes 1 - 32 0.861732

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 3.8E-19 109 190

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|958
Ophiocordyceps australis map64 (Brazil) OphauB2|6430
Ophiocordyceps camponoti-floridani Ophcf2|03842 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3693
Ophiocordyceps kimflemingae Ophio5|7659
Ophiocordyceps subramaniannii Hirsu2|4247

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03842
MLNSRRALAAAAAIVTFFFLLSRDHKATPAVAAKDRPPSSGSDFGSASPWSGSSVGRQRLQQPMMDTSRLTVQDK
LAYAYPYDRAAKFPAYIWQTWKKTPADEGFEFREQEASWSTQHPGFVHEVLSDATADSLLSLLYASVPEVLEAYR
ALPLPVLKADFFRYLILLARGGIYSDIDTYALKSAVDWIPDSIPRDTFGLVVGIEADPDRPDWADWYSRRIQFCQ
WTIQSKPGHPVLRDVVARITNHTLTVKRESGLSAFPGSKVIEFTGPALWTDVLMDYFNDDRYFHTRDSKAPIDWH
SFTGMQNIKRVGDVVVLPITSFSPGVEQMGSKDVDDPMAFVKHDFEGTWKPESERHIGEKKETALDALSSHLARQ
LLRIADVKAGDRIVVSLGNGHEFAALTYAVYKLGAVLVPLNPTLGPEQVRAALTLRTWRWLRRSLLRAPRLQIVI
TYNIDNSININTNNTLPPLSPSSIINIQFTSGTTATPKAAQLSHRSILNNGNLIAHRMGLVPSDAIVVPPPLFHC
FGSVLGYMATATTGAAILFPSPAFDPVASLRMAIDHDATGLYGVPTMFIAMLEALDKMDEKPARLTKGIASGSSV
SESLMRRIHDRLGLGDLVICYGQTETGPVSCMTTPGDPPDKLLSSVGRPLPHTAVKIVSPTDRSVIVPVGEKGEL
AVSGYHLMEGYYDDPDRTAEVRVREPDVQGSDSVWMYSGDQAVMSADGYVSITGRIKDLIIRGGENINPLEIEEC
LAQLPAIRDVSVVGVPCPRLGEAVAAIVRPAADHLTADAVRDRVRDRLSSHLVPKHVLFWPDEFPKTASGKVQKF
KLRDEAVAKLRTSQQS*
Coding >Ophcf2|03842
ATGCTCAACTCACGCCGCGCCCTGGCCGCCGCCGCCGCAATCGTCACCTTTTTCTTCCTCCTCTCGCGCGATCAC
AAGGCTACACCCGCCGTAGCGGCCAAGGACCGTCCGCCCTCGTCTGGCTCCGACTTCGGCTCCGCTTCTCCTTGG
TCCGGCAGCTCCGTTGGCCGACAGAGGCTCCAGCAGCCGATGATGGACACGTCGCGGCTGACAGTGCAGGACAAA
CTCGCCTACGCTTACCCCTACGACCGAGCCGCCAAGTTCCCCGCCTACATTTGGCAGACGTGGAAGAAGACGCCG
GCGGACGAGGGCTTCGAGTTCCGCGAACAAGAGGCCTCGTGGTCGACTCAACACCCGGGCTTCGTCCACGAGGTG
CTCTCCGACGCCACGGCCGATAGCCTCCTCAGCCTACTGTACGCGTCGGTGCCCGAGGTGCTCGAGGCCTACCGC
GCCCTGCCGCTGCCGGTCCTCAAGGCAGACTTCTTCCGTTACCTCATCTTGCTGGCCCGCGGCGGCATCTACTCC
GACATCGACACATACGCCCTCAAGAGCGCCGTCGACTGGATCCCCGACTCGATCCCGCGCGATACCTTTGGCCTT
GTCGTCGGCATCGAGGCCGACCCGGACCGTCCGGACTGGGCAGACTGGTACAGTCGTCGCATTCAGTTCTGCCAG
TGGACCATCCAAAGCAAGCCCGGCCATCCTGTTCTGCGCGATGTCGTCGCCCGCATCACCAACCATACCCTCACC
GTCAAGCGCGAGAGCGGCCTGTCCGCCTTTCCCGGCAGCAAGGTCATCGAATTCACCGGCCCGGCCCTGTGGACC
GACGTGCTGATGGACTACTTCAACGACGACCGCTACTTCCACACCCGCGACAGCAAGGCGCCCATCGACTGGCAC
AGCTTCACCGGCATGCAGAACATCAAGCGCGTCGGTGACGTCGTCGTCCTGCCCATCACCAGCTTCTCGCCAGGC
GTGGAGCAGATGGGCTCCAAGGACGTCGACGATCCCATGGCCTTTGTCAAGCACGATTTCGAGGGTACGTGGAAG
CCCGAAAGCGAGCGGCACATCGGGGAGAAGAAGGAGACCGCCCTAGACGCCCTATCATCGCACCTCGCGCGCCAA
CTCCTCCGCATAGCCGACGTCAAGGCGGGAGATCGCATCGTGGTCTCGCTCGGCAACGGGCATGAGTTCGCAGCC
CTCACCTACGCCGTCTACAAGTTGGGGGCTGTGCTCGTGCCGCTCAATCCGACGCTGGGGCCGGAGCAGGTCAGG
GCTGCGTTGACCTTACGGACGTGGAGATGGCTTCGTCGTTCCCTACTCCGAGCTCCTCGACTCCAAATCGTCATC
ACTTACAACATCGACAACAGCATCAACATCAACACCAACAACACCCTTCCCCCCCTCTCCCCCTCATCCATCATC
AACATCCAATTCACCTCCGGCACGACAGCCACCCCCAAAGCCGCCCAGCTCTCCCACCGCTCCATCCTCAACAAC
GGCAACCTCATCGCCCACCGAATGGGCCTCGTCCCCTCCGACGCCATCGTCGTCCCCCCCCCGCTGTTCCACTGC
TTCGGCTCCGTCCTCGGATACATGGCCACAGCCACCACCGGAGCCGCCATCCTATTCCCCAGCCCGGCTTTTGAT
CCCGTCGCCTCGCTGCGAATGGCTATCGATCACGATGCTACCGGTCTGTATGGCGTGCCTACCATGTTCATCGCC
ATGCTCGAGGCCCTCGATAAGATGGACGAGAAACCGGCAAGACTTACAAAGGGTATCGCCTCGGGAAGCAGCGTG
TCCGAATCGCTGATGCGTCGCATTCACGACCGTCTCGGCCTCGGCGACCTCGTCATCTGCTACGGTCAGACCGAG
ACGGGGCCTGTCAGCTGTATGACGACCCCCGGCGATCCTCCCGACAAGCTCCTCTCCTCCGTCGGCCGCCCGCTG
CCGCACACGGCCGTCAAGATCGTCTCGCCCACCGATCGATCCGTCATCGTGCCCGTAGGCGAAAAGGGAGAGCTC
GCCGTCTCGGGATATCACCTCATGGAAGGCTACTACGACGATCCCGACCGCACGGCAGAGGTTCGCGTCCGCGAG
CCTGACGTCCAAGGCAGCGACTCGGTCTGGATGTATTCGGGAGACCAGGCCGTCATGTCGGCTGACGGATACGTA
TCCATCACCGGCCGCATCAAGGACCTCATCATCCGAGGCGGTGAGAACATCAATCCCCTCGAGATTGAGGAATGT
CTCGCTCAGCTTCCCGCCATACGCGACGTCAGCGTCGTCGGCGTTCCCTGTCCACGTCTTGGCGAAGCTGTCGCC
GCCATTGTCCGGCCCGCCGCCGACCATCTGACCGCTGATGCCGTTCGCGATCGGGTTCGAGACAGACTGTCCAGC
CACCTCGTACCCAAGCACGTCTTGTTCTGGCCCGACGAATTCCCCAAGACGGCCAGCGGCAAGGTTCAAAAGTTT
AAGCTGCGCGACGAGGCAGTTGCCAAGCTCCGGACCTCTCAGCAATCCTGA
Transcript >Ophcf2|03842
ATGCTCAACTCACGCCGCGCCCTGGCCGCCGCCGCCGCAATCGTCACCTTTTTCTTCCTCCTCTCGCGCGATCAC
AAGGCTACACCCGCCGTAGCGGCCAAGGACCGTCCGCCCTCGTCTGGCTCCGACTTCGGCTCCGCTTCTCCTTGG
TCCGGCAGCTCCGTTGGCCGACAGAGGCTCCAGCAGCCGATGATGGACACGTCGCGGCTGACAGTGCAGGACAAA
CTCGCCTACGCTTACCCCTACGACCGAGCCGCCAAGTTCCCCGCCTACATTTGGCAGACGTGGAAGAAGACGCCG
GCGGACGAGGGCTTCGAGTTCCGCGAACAAGAGGCCTCGTGGTCGACTCAACACCCGGGCTTCGTCCACGAGGTG
CTCTCCGACGCCACGGCCGATAGCCTCCTCAGCCTACTGTACGCGTCGGTGCCCGAGGTGCTCGAGGCCTACCGC
GCCCTGCCGCTGCCGGTCCTCAAGGCAGACTTCTTCCGTTACCTCATCTTGCTGGCCCGCGGCGGCATCTACTCC
GACATCGACACATACGCCCTCAAGAGCGCCGTCGACTGGATCCCCGACTCGATCCCGCGCGATACCTTTGGCCTT
GTCGTCGGCATCGAGGCCGACCCGGACCGTCCGGACTGGGCAGACTGGTACAGTCGTCGCATTCAGTTCTGCCAG
TGGACCATCCAAAGCAAGCCCGGCCATCCTGTTCTGCGCGATGTCGTCGCCCGCATCACCAACCATACCCTCACC
GTCAAGCGCGAGAGCGGCCTGTCCGCCTTTCCCGGCAGCAAGGTCATCGAATTCACCGGCCCGGCCCTGTGGACC
GACGTGCTGATGGACTACTTCAACGACGACCGCTACTTCCACACCCGCGACAGCAAGGCGCCCATCGACTGGCAC
AGCTTCACCGGCATGCAGAACATCAAGCGCGTCGGTGACGTCGTCGTCCTGCCCATCACCAGCTTCTCGCCAGGC
GTGGAGCAGATGGGCTCCAAGGACGTCGACGATCCCATGGCCTTTGTCAAGCACGATTTCGAGGGTACGTGGAAG
CCCGAAAGCGAGCGGCACATCGGGGAGAAGAAGGAGACCGCCCTAGACGCCCTATCATCGCACCTCGCGCGCCAA
CTCCTCCGCATAGCCGACGTCAAGGCGGGAGATCGCATCGTGGTCTCGCTCGGCAACGGGCATGAGTTCGCAGCC
CTCACCTACGCCGTCTACAAGTTGGGGGCTGTGCTCGTGCCGCTCAATCCGACGCTGGGGCCGGAGCAGGTCAGG
GCTGCGTTGACCTTACGGACGTGGAGATGGCTTCGTCGTTCCCTACTCCGAGCTCCTCGACTCCAAATCGTCATC
ACTTACAACATCGACAACAGCATCAACATCAACACCAACAACACCCTTCCCCCCCTCTCCCCCTCATCCATCATC
AACATCCAATTCACCTCCGGCACGACAGCCACCCCCAAAGCCGCCCAGCTCTCCCACCGCTCCATCCTCAACAAC
GGCAACCTCATCGCCCACCGAATGGGCCTCGTCCCCTCCGACGCCATCGTCGTCCCCCCCCCGCTGTTCCACTGC
TTCGGCTCCGTCCTCGGATACATGGCCACAGCCACCACCGGAGCCGCCATCCTATTCCCCAGCCCGGCTTTTGAT
CCCGTCGCCTCGCTGCGAATGGCTATCGATCACGATGCTACCGGTCTGTATGGCGTGCCTACCATGTTCATCGCC
ATGCTCGAGGCCCTCGATAAGATGGACGAGAAACCGGCAAGACTTACAAAGGGTATCGCCTCGGGAAGCAGCGTG
TCCGAATCGCTGATGCGTCGCATTCACGACCGTCTCGGCCTCGGCGACCTCGTCATCTGCTACGGTCAGACCGAG
ACGGGGCCTGTCAGCTGTATGACGACCCCCGGCGATCCTCCCGACAAGCTCCTCTCCTCCGTCGGCCGCCCGCTG
CCGCACACGGCCGTCAAGATCGTCTCGCCCACCGATCGATCCGTCATCGTGCCCGTAGGCGAAAAGGGAGAGCTC
GCCGTCTCGGGATATCACCTCATGGAAGGCTACTACGACGATCCCGACCGCACGGCAGAGGTTCGCGTCCGCGAG
CCTGACGTCCAAGGCAGCGACTCGGTCTGGATGTATTCGGGAGACCAGGCCGTCATGTCGGCTGACGGATACGTA
TCCATCACCGGCCGCATCAAGGACCTCATCATCCGAGGCGGTGAGAACATCAATCCCCTCGAGATTGAGGAATGT
CTCGCTCAGCTTCCCGCCATACGCGACGTCAGCGTCGTCGGCGTTCCCTGTCCACGTCTTGGCGAAGCTGTCGCC
GCCATTGTCCGGCCCGCCGCCGACCATCTGACCGCTGATGCCGTTCGCGATCGGGTTCGAGACAGACTGTCCAGC
CACCTCGTACCCAAGCACGTCTTGTTCTGGCCCGACGAATTCCCCAAGACGGCCAGCGGCAAGGTTCAAAAGTTT
AAGCTGCGCGACGAGGCAGTTGCCAAGCTCCGGACCTCTCAGCAATCCTGA
Gene >Ophcf2|03842
ATGCTCAACTCACGCCGCGCCCTGGCCGCCGCCGCCGCAATCGTCACCTTTTTCTTCCTCCTCTCGCGCGATCAC
AAGGCTACACCCGCCGTAGCGGCCAAGGACCGTCCGCCCTCGTCTGGCTCCGACTTCGGCTCCGCTTCTCCTTGG
TCCGGCAGCTCCGTTGGCCGACAGAGGCTCCAGCAGCCGATGATGGACACGTCGCGGCTGACAGTGCAGGACAAA
CTCGCCTACGCTTACCCCTACGACCGAGCCGCCAAGTTCCCCGCCTACATTTGGCAGACGTGGAAGAAGACGCCG
GCGGACGAGGGCTTCGAGTTCCGCGAACAAGAGGCCTCGTGGTCGACTCAACACCCGGGCTTCGTCCACGAGGTG
CTCTCCGACGCCACGGCCGATAGCCTCCTCAGCCTACTGTACGCGTCGGTGCCCGAGGTGCTCGAGGCCTACCGC
GCCCTGCCGCTGCCGGTCCTCAAGGCAGACTTCTTCCGTTACCTCATCTTGCTGGCCCGCGGCGGCATCTACTCC
GACATCGACACATACGCCCTCAAGAGCGCCGTCGACTGGATCCCCGACTCGATCCCGCGCGATACCTTTGGCCTT
GTCGTCGGCATCGAGGCCGACCCGGACCGTCCGGACTGGGCAGACTGGTACAGTCGTCGCATTCAGTTCTGCCAG
TGGACCATCCAAAGCAAGCCCGGCCATCCTGTTCTGCGCGATGTCGTCGCCCGCATCACCAACCATACCCTCACC
GTCAAGCGCGAGAGCGGCCTGTCCGCCTTTCCCGGCAGCAAGGTCATCGAATTCACCGGCCCGGCCCTGTGGACC
GACGTGCTGATGGACTACTTCAACGACGACCGCTACTTCCACACCCGCGACAGCAAGGCGCCCATCGACTGGCAC
AGCTTCACCGGCATGCAGAACATCAAGCGCGTCGGTGACGTCGTCGTCCTGCCCATCACCAGCTTCTCGCCAGGC
GTGGAGCAGATGGGCTCCAAGGACGTCGACGATCCCATGGCCTTTGTCAAGCACGATTTCGAGGGTTTGTCTTTC
CCGTCTTTCTCTTGCTCCTCATCTCTCGATCTGACCTGTCACGCAGGTACGTGGAAGCCCGAAAGCGAGCGGCAC
ATCGGGGAGAAGAAGGAGACGTCAGCGTAAGATACGTCTCTGCAGCTAGGATCACGATTCGCCCACCATATTGTC
CTTTCGATCTCCTCATCGATGGTTTCCCATGGGCACCATCACCACGGCACGGCACGGAACTGGCGTTGAAAATTA
GGACACGGGGATAGCGAGGGAATCCGCTCCCCACAAGTGAAAACCAAAAAAAGCAAACAAAAAAAGAGACGTCGA
CGATTCGCCCGTCGATGTGAGTAGGCACTGCCTCTTGTCCGGTCCCCGTGTCACATCAATACATACAAATCGTAC
CGTAACGGTATAAGCCACGTTACGGGTTCATATCGCAACCTTCGACTCCCTCCCACCCCTCGCCTGTAAAATCCC
GCCATTGCAACCATGACCAGCGTCCTAGTACGAATGAGGCAAACCCGGAATGACGCTCACGTACGATGGCGAACC
CCTCGTATTCAGCAGGCGGGTATAATGTTGTGACGCTGCCTCGCAATAGGGTGACAGGATGCTACTAGCCGGATT
GACGCACTCTGCCATCTCGACCAGGCTTTACGAATATGGTATGCGTTTGTATCGTAGCATATAGACAGCTGAAAC
CGCGGACTTGTCGGACGGGACTTGGATGATAGACATGTCATCAGCCTCTCGTCGATCCCTCTCATGTCTCCCTGT
TCTCTAACCACCAACAGCCCATCATGATCCTCTTCCGCCGCCTCCTCTCCACCGCAACCCTAAGCTTCGCCCGCG
GCCCATCACAAGTCCGTCGTCCACCACCCCCTCACCACCTCACCACCTCATCACCTCATCCCCCCCCAAACTAAC
AAACTAACAAACACCTCCCAGCCAAGCCTCCTCACCAACACCATCCCCTCCCACCTCTCAACCATCGTCACCCGC
CACGGCACCCGCCCCGCCGTCATCTCCCGCACGCCCTCCCGCCACGGCCCCCCCAGGAAACAACGTTGACCTACA
GCGCCCTAGACGCCCTATCATCGCACCTCGCGCGCCAACTCCTCCGCATAGCCGACGTCAAGGCGGGAGATCGCA
TCGTGGTCTCGCTCGGCAACGGGCATGAGTTCGCAGCCCTCACCTACGCCGTCTACAAGTTGGGGGCTGTGCTCG
TGCCGCTCAATCCGACGCTGGGGCCGGAGCAGGTCAGGGCTGCGTTGACCTTGTTGTCGGCTAGGGTTCTGGTCT
TGGGGGCTGCTGTGGATTTGGCCTATCGGCCCGGTAGGGGGAGGAGTAACGCTCGGCTTGTGGATGGTATCGTGG
GAGGGAAGAGGCCTGAGGGATTGGAGAGGGTGGTGCTGCTGGATAATCGGGAGCAGCATCGGGCGGATGTGTTTG
ATGATGACGTCGATATTGGCTTATTCCATCGTCTAGACGGACGTGGAGATGGCTTCGTCGTTCCCTACTCCGAGC
TCCTCGACTCCAAATCGTCATCACTTACAACATCGACAACAGCATCAACATCAACACCAACAACACCCTTCCCCC
CCTCTCCCCCTCATCCATCATCAACATCCAATTCACCTCCGGCACGACAGCCACCCCCAAAGCCGCCCAGCTCTC
CCACCGCTCCATCCTCAACAACGGCAACCTCATCGCCCACCGAATGGGCCTCGTCCCCTCCGACGCCATCGTCGT
CCCCCCCCCGCTGTTCCACTGCTTCGGCTCCGTCCTCGGATACATGGCCACAGCCACCACCGGAGCCGCCATCCT
ATTCCCCAGCCCGGCTTTTGATCCCGTCGCCTCGCTGCGAATGGCTATCGATCACGATGCTACCGGTCTGTATGG
CGTGCCTACCATGTTCATCGCCATGCTCGAGGCCCTCGATAAGATGGACGAGAAACCGGCAAGACTTACAAAGGG
TATCGCCTCGGGAAGCAGCGTGTCCGAATCGCTGATGCGTCGCATTCACGACCGTCTCGGCCTCGGCGACCTCGT
CATCTGCTACGGTCAGACCGAGACGGGGCCTGTCAGCTGTATGACGACCCCCGGCGATCCTCCCGACAAGCTCCT
CTCCTCCGTCGGCCGCCCGCTGCCGCACACGGCCGTCAAGATCGTCTCGCCCACCGATCGATCCGTCATCGTGCC
CGTAGGCGAAAAGGGAGAGCTCGCCGTCTCGGGATATCACCTCATGGAAGGCTACTACGACGATCCCGACCGCAC
GGCAGAGGTTCGCGTCCGCGAGCCTGACGTCCAAGGCAGCGACTCGGTCTGGATGTATTCGGGAGACCAGGCCGT
CATGTCGGCTGACGGATACGTATCCATCACCGGCCGCATCAAGGACCTCATCATCCGAGGCGGTGAGAACATCAA
TCCCCTCGAGATTGAGGAATGTCTCGCTCAGCTTCCCGCCATACGCGACGTCAGCGTCGTCGGCGTTCCCTGTCC
ACGTCTTGGCGAAGCTGTCGCCGCCATTGTCCGGCCCGCCGCCGACCATCTGACCGCTGATGCCGTTCGCGATCG
GGTTCGAGACAGACTGTCCAGCCACCTCGTACCCAAGCACGTCTTGTTCTGGCCCGACGAATTCCCCAAGACGGC
CAGCGGCAAGGTTCAAAAGTTTAAGCTGCGCGACGAGGCAGTTGCCAAGCTCCGGACCTCTCAGCAATCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail