Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03841
Gene name
Locationscaffold_04:82456..84013
Strand+
Gene length (bp)1557
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 1.4E-42 141 370
PF08390 TRAM1 TRAM1-like protein 7.4E-21 79 137

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.0934 0.0958 0.0221 0.1316 0.094 0.0034 0.7678 0.4054 0.3477 0.0389

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 55 72 17
2 103 125 22
3 146 168 22
4 191 208 17
5 272 294 22
6 351 373 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 64.83 36.81 92.85
Alive In ants, during behavior modification 145.10 79.86 210.35
Dead In ants, recently dead 136.10 75.81 196.39

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.759400 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup1356
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3884
Ophiocordyceps australis map64 (Brazil) OphauB2|5
Ophiocordyceps camponoti-floridani Ophcf2|03841 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3691
Ophiocordyceps kimflemingae Ophio5|7661
Ophiocordyceps subramaniannii Hirsu2|10769

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03841
MTDPEYSSVPLPPRNMNGPLYMQKSGSSVVLVRRLRRKDDGPWRQLTRWLIENQIGLSFNLLALLFLAHTFIPKA
RAHTRRFFHLSYYDNNSAKYGVGFDDVYVILFCIVLFTGLRAATMEYVLAPFARLQGLTKRKALTRFSEQAWLFL
YYSVFWSIGMYIYTTSPYFLNLRELWTNWPLRQISGLQKGYIMAQLAFWLQQMIVINIEDRRKDHWQMISHHIVT
TMLIYSCYCYHQTRVGNLILVIMDVVDLFFPVAKCLKYTGHRKLCDFAFGVFMLSWFVARHIFYMMICWSVYAHS
AVIMPYSCWHGQGEKLTGPEKTPAGFSYIFEPFLNASGRVCFNHTIKWCFLAPLLFLQFITIIWFIMIIRVAVKV
IRGDGAEDTRSDDEGYAEDEDDEFVYEEARPLEEEVGVEALDLKGWERRSGVRRQASSSGVSLPGHSDRKELLGR
IGCEKQVD*
Coding >Ophcf2|03841
ATGACCGATCCCGAATACTCGTCCGTCCCTCTGCCGCCCCGCAACATGAATGGGCCGCTCTATATGCAAAAGTCT
GGCTCCAGCGTCGTTCTCGTCCGCAGGCTCAGACGCAAGGACGATGGTCCCTGGAGACAGCTTACTCGCTGGCTC
ATCGAAAACCAGATTGGCCTGTCTTTCAACCTCCTAGCTCTGCTCTTCCTCGCTCATACCTTCATTCCCAAGGCC
CGCGCACACACCCGTCGCTTCTTCCACCTCTCCTACTATGACAATAACTCTGCTAAATACGGCGTTGGCTTTGAC
GATGTCTATGTCATTCTCTTCTGCATCGTCCTGTTTACCGGCCTTCGCGCCGCCACCATGGAATACGTCTTGGCT
CCTTTTGCCAGACTCCAGGGCCTCACCAAGCGCAAGGCCCTCACCCGCTTCAGTGAGCAGGCCTGGCTCTTTCTT
TACTACAGTGTATTCTGGTCCATTGGCATGTACATATACACAACGTCGCCCTACTTCCTCAACCTGCGAGAGCTC
TGGACCAACTGGCCCCTCCGCCAGATCAGCGGCTTGCAAAAGGGCTACATTATGGCCCAGCTCGCGTTTTGGTTG
CAGCAAATGATCGTCATCAATATCGAGGACCGCCGTAAGGATCATTGGCAGATGATATCCCACCACATCGTCACC
ACGATGCTCATCTACTCGTGCTACTGTTATCATCAAACCCGAGTCGGCAATTTGATCCTCGTCATCATGGACGTT
GTCGATCTTTTTTTCCCGGTTGCCAAGTGTCTCAAGTACACGGGCCACAGAAAGCTGTGCGATTTTGCCTTTGGC
GTCTTCATGCTCTCTTGGTTCGTCGCTCGCCACATCTTTTACATGATGATCTGCTGGTCTGTCTACGCCCACTCG
GCCGTCATCATGCCCTACAGCTGCTGGCACGGACAAGGCGAGAAGCTCACAGGCCCCGAGAAGACGCCTGCCGGC
TTCTCTTACATTTTTGAGCCCTTCTTGAACGCCTCGGGACGTGTTTGCTTCAACCACACGATTAAGTGGTGCTTC
CTCGCGCCGCTGCTGTTTTTGCAATTCATCACGATAATCTGGTTCATCATGATCATCCGCGTGGCCGTCAAGGTG
ATCCGCGGCGACGGTGCCGAGGACACCCGCAGCGACGACGAGGGCTATGCTGAGGACGAAGACGACGAGTTCGTT
TACGAGGAGGCTCGGCCACTCGAGGAGGAGGTGGGCGTCGAGGCGCTCGACCTCAAGGGCTGGGAGCGTCGGTCC
GGAGTGAGGCGTCAGGCCAGCAGCTCCGGCGTGAGTCTTCCGGGTCACAGCGACCGCAAGGAGCTGCTGGGACGC
ATCGGGTGCGAGAAGCAGGTCGATTGA
Transcript >Ophcf2|03841
ATGACCGATCCCGAATACTCGTCCGTCCCTCTGCCGCCCCGCAACATGAATGGGCCGCTCTATATGCAAAAGTCT
GGCTCCAGCGTCGTTCTCGTCCGCAGGCTCAGACGCAAGGACGATGGTCCCTGGAGACAGCTTACTCGCTGGCTC
ATCGAAAACCAGATTGGCCTGTCTTTCAACCTCCTAGCTCTGCTCTTCCTCGCTCATACCTTCATTCCCAAGGCC
CGCGCACACACCCGTCGCTTCTTCCACCTCTCCTACTATGACAATAACTCTGCTAAATACGGCGTTGGCTTTGAC
GATGTCTATGTCATTCTCTTCTGCATCGTCCTGTTTACCGGCCTTCGCGCCGCCACCATGGAATACGTCTTGGCT
CCTTTTGCCAGACTCCAGGGCCTCACCAAGCGCAAGGCCCTCACCCGCTTCAGTGAGCAGGCCTGGCTCTTTCTT
TACTACAGTGTATTCTGGTCCATTGGCATGTACATATACACAACGTCGCCCTACTTCCTCAACCTGCGAGAGCTC
TGGACCAACTGGCCCCTCCGCCAGATCAGCGGCTTGCAAAAGGGCTACATTATGGCCCAGCTCGCGTTTTGGTTG
CAGCAAATGATCGTCATCAATATCGAGGACCGCCGTAAGGATCATTGGCAGATGATATCCCACCACATCGTCACC
ACGATGCTCATCTACTCGTGCTACTGTTATCATCAAACCCGAGTCGGCAATTTGATCCTCGTCATCATGGACGTT
GTCGATCTTTTTTTCCCGGTTGCCAAGTGTCTCAAGTACACGGGCCACAGAAAGCTGTGCGATTTTGCCTTTGGC
GTCTTCATGCTCTCTTGGTTCGTCGCTCGCCACATCTTTTACATGATGATCTGCTGGTCTGTCTACGCCCACTCG
GCCGTCATCATGCCCTACAGCTGCTGGCACGGACAAGGCGAGAAGCTCACAGGCCCCGAGAAGACGCCTGCCGGC
TTCTCTTACATTTTTGAGCCCTTCTTGAACGCCTCGGGACGTGTTTGCTTCAACCACACGATTAAGTGGTGCTTC
CTCGCGCCGCTGCTGTTTTTGCAATTCATCACGATAATCTGGTTCATCATGATCATCCGCGTGGCCGTCAAGGTG
ATCCGCGGCGACGGTGCCGAGGACACCCGCAGCGACGACGAGGGCTATGCTGAGGACGAAGACGACGAGTTCGTT
TACGAGGAGGCTCGGCCACTCGAGGAGGAGGTGGGCGTCGAGGCGCTCGACCTCAAGGGCTGGGAGCGTCGGTCC
GGAGTGAGGCGTCAGGCCAGCAGCTCCGGCGTGAGTCTTCCGGGTCACAGCGACCGCAAGGAGCTGCTGGGACGC
ATCGGGTGCGAGAAGCAGGTCGATTGA
Gene >Ophcf2|03841
ATGACCGATCCCGAATACTCGTCCGTCCCTCTGCCGCCCCGCAACATGAATGGGCCGCTCTATATGCAAAAGTCT
GGCTCCAGCGTCGTTCTCGTCCGCAGGCTCAGACGCAAGGACGATGGTCCCTGGAGACAGCTTACTCGCTGGCTC
ATCGAAAACCAGATTGGTACGCTTCACCCGGGTCTCAATTGACGTCCTATGCTGATTTGGCAAATTCTAGGCCTG
TCTTTCAACCTCCTAGCTCTGCTCTTCCTCGCTCATACCTTCATTCCCAAGGCCCGCGCACACACCCGTCGCTTC
TTCCACCTCTCCTACTATGACAATAACTCTGCTAAATACGGCGTTGGCTTTGACGATGTCTATGTCATTCTCTTC
TGCATCGTCCTGTTTACCGGCCTTCGCGCCGCCACCATGGAATACGTCTTGGCTCCTTTTGCCAGACTCCAGGGC
CTCACCAAGCGCAAGGCCCTCACCCGCTTCAGTGAGCAGGCCTGGCTCTTTCTTTACTACAGTGTATTCTGGTCC
ATTGGCATGGTCAGTGTTCTAGCCTTCCCCCCCCCCCCCCCCTATCCTCTGACCGCCATTGACTTGAACGACGCA
GTACATATACACAACGTCGCCCTACTTCCTCAACCTGCGAGAGCTCTGGACCAACTGGCCCCTCCGCCAGATCAG
CGGCTTGCAAAAGGGCTACATTATGGCCCAGCTCGCGTTTTGGTTGCAGCAAATGATCGTCATCAATATCGAGGA
CCGCCGTAAGGATCATTGGCAGATGATATCCCACCACATCGTCACCACGATGCTCATCTACTCGTGCTACTGTTA
TCATCAAACCCGAGTCGGCAATTTGATCCTCGTCATCATGGACGTTGTCGATCTTTTTTTCCCGGTAAGCAGCCT
CGACCTCTCTACGTTGACAGATAACGTGCTAAACCTCGTGGGCCCCAGGTTGCCAAGTGTCTCAAGTACACGGGC
CACAGAAAGCTGTGCGATTTTGCCTTTGGCGTCTTCATGCTCTCTTGGTTCGTCGCTCGCCACATCTTTTACATG
ATGATCTGCTGGTCTGTCTACGCCCACTCGGCCGTCATCATGCCCTACAGCTGCTGGCACGGACAAGGCGAGAAG
CTCACAGGCCCCGAGAAGACGCCTGCCGGCTTCTCTTACATTTTTGAGCCCTTCTTGAACGCCTCGGGACGTGTT
TGCTTCAACCACACGATTAAGTGGTGCTTCCTCGCGCCGCTGCTGTTTTTGCAATTCATCACGATAATCTGGTTC
ATCATGATCATCCGCGTGGCCGTCAAGGTGATCCGCGGCGACGGTGCCGAGGACACCCGCAGCGACGACGAGGGC
TATGCTGAGGACGAAGACGACGAGTTCGTTTACGAGGAGGCTCGGCCACTCGAGGAGGAGGTGGGCGTCGAGGCG
CTCGACCTCAAGGGCTGGGAGCGTCGGTCCGGAGTGAGGCGTCAGGCCAGCAGCTCCGGCGTGAGTCTTCCGGGT
CACAGCGACCGCAAGGAGCTGCTGGGACGCATCGGGTGCGAGAAGCAGGTCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail