Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03841
Gene name
Locationscaffold_04:82456..84013
Strand+
Gene length (bp)1557
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 1.4E-42 141 370
PF08390 TRAM1 TRAM1-like protein 7.4E-21 79 137

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 55 72 17
2 103 125 22
3 146 168 22
4 191 208 17
5 272 294 22
6 351 373 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03841
MTDPEYSSVPLPPRNMNGPLYMQKSGSSVVLVRRLRRKDDGPWRQLTRWLIENQIGLSFNLLALLFLAHTFIPKA
RAHTRRFFHLSYYDNNSAKYGVGFDDVYVILFCIVLFTGLRAATMEYVLAPFARLQGLTKRKALTRFSEQAWLFL
YYSVFWSIGMYIYTTSPYFLNLRELWTNWPLRQISGLQKGYIMAQLAFWLQQMIVINIEDRRKDHWQMISHHIVT
TMLIYSCYCYHQTRVGNLILVIMDVVDLFFPVAKCLKYTGHRKLCDFAFGVFMLSWFVARHIFYMMICWSVYAHS
AVIMPYSCWHGQGEKLTGPEKTPAGFSYIFEPFLNASGRVCFNHTIKWCFLAPLLFLQFITIIWFIMIIRVAVKV
IRGDGAEDTRSDDEGYAEDEDDEFVYEEARPLEEEVGVEALDLKGWERRSGVRRQASSSGVSLPGHSDRKELLGR
IGCEKQVD*
Coding >Ophcf2|03841
ATGACCGATCCCGAATACTCGTCCGTCCCTCTGCCGCCCCGCAACATGAATGGGCCGCTCTATATGCAAAAGTCT
GGCTCCAGCGTCGTTCTCGTCCGCAGGCTCAGACGCAAGGACGATGGTCCCTGGAGACAGCTTACTCGCTGGCTC
ATCGAAAACCAGATTGGCCTGTCTTTCAACCTCCTAGCTCTGCTCTTCCTCGCTCATACCTTCATTCCCAAGGCC
CGCGCACACACCCGTCGCTTCTTCCACCTCTCCTACTATGACAATAACTCTGCTAAATACGGCGTTGGCTTTGAC
GATGTCTATGTCATTCTCTTCTGCATCGTCCTGTTTACCGGCCTTCGCGCCGCCACCATGGAATACGTCTTGGCT
CCTTTTGCCAGACTCCAGGGCCTCACCAAGCGCAAGGCCCTCACCCGCTTCAGTGAGCAGGCCTGGCTCTTTCTT
TACTACAGTGTATTCTGGTCCATTGGCATGTACATATACACAACGTCGCCCTACTTCCTCAACCTGCGAGAGCTC
TGGACCAACTGGCCCCTCCGCCAGATCAGCGGCTTGCAAAAGGGCTACATTATGGCCCAGCTCGCGTTTTGGTTG
CAGCAAATGATCGTCATCAATATCGAGGACCGCCGTAAGGATCATTGGCAGATGATATCCCACCACATCGTCACC
ACGATGCTCATCTACTCGTGCTACTGTTATCATCAAACCCGAGTCGGCAATTTGATCCTCGTCATCATGGACGTT
GTCGATCTTTTTTTCCCGGTTGCCAAGTGTCTCAAGTACACGGGCCACAGAAAGCTGTGCGATTTTGCCTTTGGC
GTCTTCATGCTCTCTTGGTTCGTCGCTCGCCACATCTTTTACATGATGATCTGCTGGTCTGTCTACGCCCACTCG
GCCGTCATCATGCCCTACAGCTGCTGGCACGGACAAGGCGAGAAGCTCACAGGCCCCGAGAAGACGCCTGCCGGC
TTCTCTTACATTTTTGAGCCCTTCTTGAACGCCTCGGGACGTGTTTGCTTCAACCACACGATTAAGTGGTGCTTC
CTCGCGCCGCTGCTGTTTTTGCAATTCATCACGATAATCTGGTTCATCATGATCATCCGCGTGGCCGTCAAGGTG
ATCCGCGGCGACGGTGCCGAGGACACCCGCAGCGACGACGAGGGCTATGCTGAGGACGAAGACGACGAGTTCGTT
TACGAGGAGGCTCGGCCACTCGAGGAGGAGGTGGGCGTCGAGGCGCTCGACCTCAAGGGCTGGGAGCGTCGGTCC
GGAGTGAGGCGTCAGGCCAGCAGCTCCGGCGTGAGTCTTCCGGGTCACAGCGACCGCAAGGAGCTGCTGGGACGC
ATCGGGTGCGAGAAGCAGGTCGATTGA
Transcript >Ophcf2|03841
ATGACCGATCCCGAATACTCGTCCGTCCCTCTGCCGCCCCGCAACATGAATGGGCCGCTCTATATGCAAAAGTCT
GGCTCCAGCGTCGTTCTCGTCCGCAGGCTCAGACGCAAGGACGATGGTCCCTGGAGACAGCTTACTCGCTGGCTC
ATCGAAAACCAGATTGGCCTGTCTTTCAACCTCCTAGCTCTGCTCTTCCTCGCTCATACCTTCATTCCCAAGGCC
CGCGCACACACCCGTCGCTTCTTCCACCTCTCCTACTATGACAATAACTCTGCTAAATACGGCGTTGGCTTTGAC
GATGTCTATGTCATTCTCTTCTGCATCGTCCTGTTTACCGGCCTTCGCGCCGCCACCATGGAATACGTCTTGGCT
CCTTTTGCCAGACTCCAGGGCCTCACCAAGCGCAAGGCCCTCACCCGCTTCAGTGAGCAGGCCTGGCTCTTTCTT
TACTACAGTGTATTCTGGTCCATTGGCATGTACATATACACAACGTCGCCCTACTTCCTCAACCTGCGAGAGCTC
TGGACCAACTGGCCCCTCCGCCAGATCAGCGGCTTGCAAAAGGGCTACATTATGGCCCAGCTCGCGTTTTGGTTG
CAGCAAATGATCGTCATCAATATCGAGGACCGCCGTAAGGATCATTGGCAGATGATATCCCACCACATCGTCACC
ACGATGCTCATCTACTCGTGCTACTGTTATCATCAAACCCGAGTCGGCAATTTGATCCTCGTCATCATGGACGTT
GTCGATCTTTTTTTCCCGGTTGCCAAGTGTCTCAAGTACACGGGCCACAGAAAGCTGTGCGATTTTGCCTTTGGC
GTCTTCATGCTCTCTTGGTTCGTCGCTCGCCACATCTTTTACATGATGATCTGCTGGTCTGTCTACGCCCACTCG
GCCGTCATCATGCCCTACAGCTGCTGGCACGGACAAGGCGAGAAGCTCACAGGCCCCGAGAAGACGCCTGCCGGC
TTCTCTTACATTTTTGAGCCCTTCTTGAACGCCTCGGGACGTGTTTGCTTCAACCACACGATTAAGTGGTGCTTC
CTCGCGCCGCTGCTGTTTTTGCAATTCATCACGATAATCTGGTTCATCATGATCATCCGCGTGGCCGTCAAGGTG
ATCCGCGGCGACGGTGCCGAGGACACCCGCAGCGACGACGAGGGCTATGCTGAGGACGAAGACGACGAGTTCGTT
TACGAGGAGGCTCGGCCACTCGAGGAGGAGGTGGGCGTCGAGGCGCTCGACCTCAAGGGCTGGGAGCGTCGGTCC
GGAGTGAGGCGTCAGGCCAGCAGCTCCGGCGTGAGTCTTCCGGGTCACAGCGACCGCAAGGAGCTGCTGGGACGC
ATCGGGTGCGAGAAGCAGGTCGATTGA
Gene >Ophcf2|03841
ATGACCGATCCCGAATACTCGTCCGTCCCTCTGCCGCCCCGCAACATGAATGGGCCGCTCTATATGCAAAAGTCT
GGCTCCAGCGTCGTTCTCGTCCGCAGGCTCAGACGCAAGGACGATGGTCCCTGGAGACAGCTTACTCGCTGGCTC
ATCGAAAACCAGATTGGTACGCTTCACCCGGGTCTCAATTGACGTCCTATGCTGATTTGGCAAATTCTAGGCCTG
TCTTTCAACCTCCTAGCTCTGCTCTTCCTCGCTCATACCTTCATTCCCAAGGCCCGCGCACACACCCGTCGCTTC
TTCCACCTCTCCTACTATGACAATAACTCTGCTAAATACGGCGTTGGCTTTGACGATGTCTATGTCATTCTCTTC
TGCATCGTCCTGTTTACCGGCCTTCGCGCCGCCACCATGGAATACGTCTTGGCTCCTTTTGCCAGACTCCAGGGC
CTCACCAAGCGCAAGGCCCTCACCCGCTTCAGTGAGCAGGCCTGGCTCTTTCTTTACTACAGTGTATTCTGGTCC
ATTGGCATGGTCAGTGTTCTAGCCTTCCCCCCCCCCCCCCCCTATCCTCTGACCGCCATTGACTTGAACGACGCA
GTACATATACACAACGTCGCCCTACTTCCTCAACCTGCGAGAGCTCTGGACCAACTGGCCCCTCCGCCAGATCAG
CGGCTTGCAAAAGGGCTACATTATGGCCCAGCTCGCGTTTTGGTTGCAGCAAATGATCGTCATCAATATCGAGGA
CCGCCGTAAGGATCATTGGCAGATGATATCCCACCACATCGTCACCACGATGCTCATCTACTCGTGCTACTGTTA
TCATCAAACCCGAGTCGGCAATTTGATCCTCGTCATCATGGACGTTGTCGATCTTTTTTTCCCGGTAAGCAGCCT
CGACCTCTCTACGTTGACAGATAACGTGCTAAACCTCGTGGGCCCCAGGTTGCCAAGTGTCTCAAGTACACGGGC
CACAGAAAGCTGTGCGATTTTGCCTTTGGCGTCTTCATGCTCTCTTGGTTCGTCGCTCGCCACATCTTTTACATG
ATGATCTGCTGGTCTGTCTACGCCCACTCGGCCGTCATCATGCCCTACAGCTGCTGGCACGGACAAGGCGAGAAG
CTCACAGGCCCCGAGAAGACGCCTGCCGGCTTCTCTTACATTTTTGAGCCCTTCTTGAACGCCTCGGGACGTGTT
TGCTTCAACCACACGATTAAGTGGTGCTTCCTCGCGCCGCTGCTGTTTTTGCAATTCATCACGATAATCTGGTTC
ATCATGATCATCCGCGTGGCCGTCAAGGTGATCCGCGGCGACGGTGCCGAGGACACCCGCAGCGACGACGAGGGC
TATGCTGAGGACGAAGACGACGAGTTCGTTTACGAGGAGGCTCGGCCACTCGAGGAGGAGGTGGGCGTCGAGGCG
CTCGACCTCAAGGGCTGGGAGCGTCGGTCCGGAGTGAGGCGTCAGGCCAGCAGCTCCGGCGTGAGTCTTCCGGGT
CACAGCGACCGCAAGGAGCTGCTGGGACGCATCGGGTGCGAGAAGCAGGTCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail