Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03840
Gene name
Locationscaffold_04:79855..80821
Strand-
Gene length (bp)966
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01027 Bax1-I Inhibitor of apoptosis-promoting Bax1 3.9E-53 72 273

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 78 100 22
2 112 129 17
3 139 158 19
4 163 182 19
5 192 214 22
6 221 243 22
7 253 275 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03840
MASNPKYQPAPQRDPEDEDYTHAPPAYAAASSSAARDEAQGLFGAPRSSEDNLPDDFKFGGSVAEATVDIRNQFI
RKVYTILTIQLLATAGLSGVSFFNASYKSWIQHHPALVWVSLIASLVFMGLTYWKRKSYPTNLLFLTAFTLTEAY
TISVIVSFYKTSIVLNAVVLTAGIFVFLTAFACQTKYDFTSWMPYLFGAVWGLFLFGLVAVFLPYNSTVELIYGG
VAALIFSAYILVDTQLVLRKHHVEEEIAAAISLYLDIINLFLAILRILNGQSNN*
Coding >Ophcf2|03840
ATGGCTTCTAACCCAAAGTACCAACCCGCGCCCCAGCGCGACCCCGAAGACGAAGACTATACTCACGCGCCCCCC
GCCTACGCCGCCGCCTCGTCATCCGCCGCCCGCGACGAGGCACAGGGTCTCTTTGGAGCCCCGCGCTCTAGCGAG
GATAATTTGCCGGACGACTTCAAGTTCGGCGGCTCTGTCGCAGAAGCCACCGTCGACATCCGCAACCAGTTCATC
CGCAAAGTCTACACCATCCTCACCATCCAGCTCCTCGCCACCGCTGGCCTCAGCGGCGTCTCCTTCTTCAACGCC
TCGTACAAGTCGTGGATCCAGCACCATCCAGCTCTCGTCTGGGTTTCCCTCATCGCCTCCCTCGTTTTCATGGGC
TTGACCTACTGGAAGCGCAAGTCGTACCCGACCAATCTCCTCTTCCTTACCGCCTTCACCCTCACCGAAGCCTAC
ACCATCTCCGTCATCGTCTCTTTCTACAAGACCTCCATCGTCCTCAACGCTGTTGTCCTCACTGCCGGTATCTTC
GTCTTCCTAACCGCCTTCGCTTGTCAGACAAAATACGACTTCACATCCTGGATGCCCTACCTCTTCGGCGCAGTC
TGGGGCCTCTTCCTCTTCGGTCTCGTCGCGGTCTTCCTGCCATACAACTCCACCGTTGAGCTCATCTACGGTGGC
GTCGCTGCTCTCATCTTCAGCGCCTACATCCTCGTCGACACCCAGCTGGTCCTCCGCAAGCACCACGTCGAGGAA
GAGATCGCCGCCGCCATCAGCCTGTACCTCGACATCATCAACCTGTTCCTCGCCATCTTGCGCATCCTCAACGGC
CAGTCCAACAACTAG
Transcript >Ophcf2|03840
ATGGCTTCTAACCCAAAGTACCAACCCGCGCCCCAGCGCGACCCCGAAGACGAAGACTATACTCACGCGCCCCCC
GCCTACGCCGCCGCCTCGTCATCCGCCGCCCGCGACGAGGCACAGGGTCTCTTTGGAGCCCCGCGCTCTAGCGAG
GATAATTTGCCGGACGACTTCAAGTTCGGCGGCTCTGTCGCAGAAGCCACCGTCGACATCCGCAACCAGTTCATC
CGCAAAGTCTACACCATCCTCACCATCCAGCTCCTCGCCACCGCTGGCCTCAGCGGCGTCTCCTTCTTCAACGCC
TCGTACAAGTCGTGGATCCAGCACCATCCAGCTCTCGTCTGGGTTTCCCTCATCGCCTCCCTCGTTTTCATGGGC
TTGACCTACTGGAAGCGCAAGTCGTACCCGACCAATCTCCTCTTCCTTACCGCCTTCACCCTCACCGAAGCCTAC
ACCATCTCCGTCATCGTCTCTTTCTACAAGACCTCCATCGTCCTCAACGCTGTTGTCCTCACTGCCGGTATCTTC
GTCTTCCTAACCGCCTTCGCTTGTCAGACAAAATACGACTTCACATCCTGGATGCCCTACCTCTTCGGCGCAGTC
TGGGGCCTCTTCCTCTTCGGTCTCGTCGCGGTCTTCCTGCCATACAACTCCACCGTTGAGCTCATCTACGGTGGC
GTCGCTGCTCTCATCTTCAGCGCCTACATCCTCGTCGACACCCAGCTGGTCCTCCGCAAGCACCACGTCGAGGAA
GAGATCGCCGCCGCCATCAGCCTGTACCTCGACATCATCAACCTGTTCCTCGCCATCTTGCGCATCCTCAACGGC
CAGTCCAACAACTAG
Gene >Ophcf2|03840
ATGGCTTCTAACCCAAAGTACCAACCCGCGCCCCAGCGCGACCCCGAAGACGAAGACTATACTCACGCGCCCCCC
GCCTACGCCGCCGCCTCGTCATCCGCCGCCCGCGACGAGGCACAGGGTCTCTTTGGAGCCCCGCGCTCTAGCGAG
GATAATTTGCCGGACGACTTCAAGGTGCTGCTTTCCTAAACCACCTCTTTCTTGGTTCCTATGTCGAGTTGCTGA
CAGCTTGTCCCGCAGTTCGGCGGCTCTGTCGCAGAAGCCACCGTCGACATCCGCAACCAGTTCATCCGCAAAGTC
TACACCATCCTCACCATCCAGCTCCTCGCCACCGCTGGCCTCAGCGGCGTCTCCTTCTTCAACGCCTCGTACAAG
TCGTGGATCCAGCACCATCCAGCTCTCGTCTGGGTTTCCGTGCGTTTCCCTTCCTCGAATCCTATTACCTTTTCC
GTCTCACGCTGACACTGCATACAGCTCATCGCCTCCCTCGTTTTCATGGGCTTGACCTACTGGAAGCGCAAGTCG
TACCCGACCAATCTCCTCTTCCTTACCGCCTTCACCCTCACCGAAGCCTACACCATCTCCGTCATCGTCTCTTTC
TACAAGACCTCCATCGTCCTCAACGCTGTTGTCCTCACTGCCGGTATCTTCGTCTTCCTAACCGCCTTCGCTTGT
CAGACAAAATACGACTTCACATCCTGGATGCCCTACCTCTTCGGCGCAGTCTGGGGCCTCTTCCTCTTCGGTCTC
GTCGCGGTCTTCCTGCCATACAACTCCACCGTTGAGCTCATCTACGGTGGCGTCGCTGCTCTCATCTTCAGCGCC
TACATCCTCGTCGACACCCAGCTGGTCCTCCGCAAGCACCACGTCGAGGAAGAGATCGCCGCCGCCATCAGCCTG
TACCTCGACATCATCAACCTGTTCCTCGCCATCTTGCGCATCCTCAACGGCCAGTCCAACAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail