Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03832
Gene name
Locationscaffold_04:62554..64210
Strand+
Gene length (bp)1656
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 94.60 53.40 135.81
Alive In ants, during behavior modification 65.79 36.43 95.15
Dead In ants, recently dead 58.65 33.63 83.68

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.051741 no
Alive Dead 0.535316 no
Dead Fungus 0.007042 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03832
MPFRLLAGRFGPRATGFRLVTPIISFRSSTNQARPSLPFLSAPTATGRPTGRRFISARRQWFRREAKLMIRYTLS
IWGCGMAVIFIMWAIEQEKRERRHPTPREWRWSTRQSLLYAHHCAGSDWPDALKAARRVVSRLENPDYDGQDVVK
LVGKPDQTLVDPGLLLEDADELLPRDISEKPEEWQRGYFDAIMLAAKAAEHVDGWLFDRLLKVTVPPECVFGPLN
PRPRPIRSGVSGVPRVEDCQPAYPSAESWYMKILGTEGFSQRQRVDATLAYASFMQFKNQVEQAEALYDLALAEA
TNKVEPARLPYDTKTLVLKDEGEPPSDNMLEVLTAIANFKARKGQLSSALPMYVSLLQARRRLSNTPPPPTSSRP
PPSFVDQVTGWFKQPPYPESPGDGTGPPWRNTLERCQEAALHLYIGEILFATSSRTNGLAWTRDAVDIAEEQLRD
GSLTKMEKEAKQRCRECLAASLNNWSAMAAQLAEAEQAKNEKSRGKSGLLPFWRVAQEPQEANSRWSSEQAAVEA
RADRAKELLNDDLEAQSGGLLSFFRA*
Coding >Ophcf2|03832
ATGCCTTTTCGGCTACTCGCCGGCCGATTTGGCCCTCGGGCTACTGGCTTCCGCCTCGTCACTCCGATAATCAGC
TTCCGAAGCTCGACAAACCAAGCGCGTCCCTCCCTTCCGTTTCTCTCCGCTCCTACAGCCACTGGCCGTCCAACC
GGACGAAGATTCATCTCTGCGCGGAGGCAATGGTTCCGCAGAGAGGCCAAGCTGATGATTCGCTACACGCTCAGT
ATCTGGGGTTGCGGAATGGCCGTTATCTTCATCATGTGGGCTATCGAGCAAGAGAAGAGAGAGCGCCGGCATCCG
ACGCCGCGAGAGTGGCGTTGGAGCACGAGGCAGTCTCTACTTTATGCTCATCATTGCGCGGGGTCTGATTGGCCC
GATGCCCTCAAGGCGGCGAGACGCGTCGTTAGTCGGCTGGAGAACCCCGATTATGATGGTCAGGACGTCGTCAAG
CTAGTCGGCAAGCCAGACCAGACACTGGTGGACCCGGGCCTGTTGCTGGAAGATGCGGACGAGCTTCTACCGCGC
GATATCTCGGAAAAACCCGAGGAATGGCAGAGGGGCTACTTTGATGCCATCATGCTGGCAGCCAAGGCGGCCGAG
CACGTCGATGGATGGCTCTTCGATCGTCTACTTAAAGTCACCGTCCCCCCTGAATGCGTCTTCGGGCCTTTGAAC
CCTCGGCCGCGTCCGATTCGGTCTGGAGTCTCGGGTGTCCCGCGAGTGGAAGACTGCCAGCCGGCATATCCCTCG
GCCGAGAGCTGGTACATGAAAATACTTGGCACTGAAGGCTTCTCGCAGAGGCAAAGGGTCGATGCCACGCTTGCG
TACGCTAGCTTTATGCAGTTCAAGAATCAGGTCGAGCAGGCCGAGGCCTTGTATGATCTGGCCTTGGCTGAGGCT
ACCAACAAGGTTGAGCCGGCTCGTCTGCCCTACGACACGAAGACGCTTGTCCTTAAAGACGAAGGCGAGCCGCCA
TCGGACAACATGCTCGAGGTCCTCACCGCCATCGCCAACTTCAAGGCCCGCAAAGGCCAACTCTCATCAGCCCTC
CCCATGTACGTCTCACTCCTCCAAGCACGCCGCCGTCTCTCGAACACGCCCCCTCCTCCGACGTCGTCTCGCCCA
CCTCCGTCCTTTGTCGATCAAGTGACGGGCTGGTTCAAGCAGCCACCCTATCCCGAATCCCCCGGGGACGGCACC
GGGCCTCCGTGGCGCAACACCCTCGAGCGCTGTCAAGAAGCGGCGCTGCACCTCTATATCGGCGAGATACTATTC
GCCACCTCTTCGCGAACAAATGGCCTGGCGTGGACGCGAGACGCCGTCGATATCGCAGAGGAGCAGCTCCGCGAC
GGCAGTCTCACCAAGATGGAAAAGGAAGCAAAGCAGAGATGTCGAGAGTGCCTCGCCGCAAGTCTGAATAACTGG
TCGGCCATGGCGGCGCAGTTGGCCGAGGCCGAGCAGGCCAAGAATGAAAAGAGCCGAGGCAAATCTGGACTGTTG
CCCTTTTGGCGCGTAGCGCAGGAGCCACAGGAAGCGAACAGTCGCTGGAGTAGCGAGCAGGCTGCGGTGGAGGCG
CGGGCGGATAGGGCGAAGGAGCTGTTGAATGATGATTTGGAGGCACAGTCGGGGGGACTTCTTTCTTTCTTCAGG
GCCTGA
Transcript >Ophcf2|03832
ATGCCTTTTCGGCTACTCGCCGGCCGATTTGGCCCTCGGGCTACTGGCTTCCGCCTCGTCACTCCGATAATCAGC
TTCCGAAGCTCGACAAACCAAGCGCGTCCCTCCCTTCCGTTTCTCTCCGCTCCTACAGCCACTGGCCGTCCAACC
GGACGAAGATTCATCTCTGCGCGGAGGCAATGGTTCCGCAGAGAGGCCAAGCTGATGATTCGCTACACGCTCAGT
ATCTGGGGTTGCGGAATGGCCGTTATCTTCATCATGTGGGCTATCGAGCAAGAGAAGAGAGAGCGCCGGCATCCG
ACGCCGCGAGAGTGGCGTTGGAGCACGAGGCAGTCTCTACTTTATGCTCATCATTGCGCGGGGTCTGATTGGCCC
GATGCCCTCAAGGCGGCGAGACGCGTCGTTAGTCGGCTGGAGAACCCCGATTATGATGGTCAGGACGTCGTCAAG
CTAGTCGGCAAGCCAGACCAGACACTGGTGGACCCGGGCCTGTTGCTGGAAGATGCGGACGAGCTTCTACCGCGC
GATATCTCGGAAAAACCCGAGGAATGGCAGAGGGGCTACTTTGATGCCATCATGCTGGCAGCCAAGGCGGCCGAG
CACGTCGATGGATGGCTCTTCGATCGTCTACTTAAAGTCACCGTCCCCCCTGAATGCGTCTTCGGGCCTTTGAAC
CCTCGGCCGCGTCCGATTCGGTCTGGAGTCTCGGGTGTCCCGCGAGTGGAAGACTGCCAGCCGGCATATCCCTCG
GCCGAGAGCTGGTACATGAAAATACTTGGCACTGAAGGCTTCTCGCAGAGGCAAAGGGTCGATGCCACGCTTGCG
TACGCTAGCTTTATGCAGTTCAAGAATCAGGTCGAGCAGGCCGAGGCCTTGTATGATCTGGCCTTGGCTGAGGCT
ACCAACAAGGTTGAGCCGGCTCGTCTGCCCTACGACACGAAGACGCTTGTCCTTAAAGACGAAGGCGAGCCGCCA
TCGGACAACATGCTCGAGGTCCTCACCGCCATCGCCAACTTCAAGGCCCGCAAAGGCCAACTCTCATCAGCCCTC
CCCATGTACGTCTCACTCCTCCAAGCACGCCGCCGTCTCTCGAACACGCCCCCTCCTCCGACGTCGTCTCGCCCA
CCTCCGTCCTTTGTCGATCAAGTGACGGGCTGGTTCAAGCAGCCACCCTATCCCGAATCCCCCGGGGACGGCACC
GGGCCTCCGTGGCGCAACACCCTCGAGCGCTGTCAAGAAGCGGCGCTGCACCTCTATATCGGCGAGATACTATTC
GCCACCTCTTCGCGAACAAATGGCCTGGCGTGGACGCGAGACGCCGTCGATATCGCAGAGGAGCAGCTCCGCGAC
GGCAGTCTCACCAAGATGGAAAAGGAAGCAAAGCAGAGATGTCGAGAGTGCCTCGCCGCAAGTCTGAATAACTGG
TCGGCCATGGCGGCGCAGTTGGCCGAGGCCGAGCAGGCCAAGAATGAAAAGAGCCGAGGCAAATCTGGACTGTTG
CCCTTTTGGCGCGTAGCGCAGGAGCCACAGGAAGCGAACAGTCGCTGGAGTAGCGAGCAGGCTGCGGTGGAGGCG
CGGGCGGATAGGGCGAAGGAGCTGTTGAATGATGATTTGGAGGCACAGTCGGGGGGACTTCTTTCTTTCTTCAGG
GCCTGA
Gene >Ophcf2|03832
ATGCCTTTTCGGCTACTCGCCGGCCGATTTGGCCCTCGGGCTACTGGCTTCCGCCTCGTCACTCCGATAATCAGC
TTCCGAAGCTCGACAAACCAAGCGCGTCCCTCCCTTCCGTTTCTCTCCGCTCCTACAGCCACTGGCCGTCCAACC
GGACGAAGATTCATCTCTGCGCGGAGGCAATGGTTCCGCAGAGAGGCCAAGCTGATGATTCGCTACACGCTCAGT
ATCTGGGGTTGCGGAATGGCCGTTATCTTCATCATGTGGGCTATCGAGCAAGAGAAGAGAGAGCGCCGGCATCCG
ACGCCGCGAGAGTGGCGTTGGAGCACGAGGCAGTCTCTACTTTATGCTCATCATTGCGCGGGGTCTGATTGGCCC
GATGCCCTCAAGGCGGCGAGACGCGTCGTTAGTCGGCTGGAGAACCCCGATTATGATGGTCAGGACGTCGTCAAG
CTAGTCGGCAAGCCAGACCAGACACTGGTGGACCCGGGCCTGTTGCTGGAAGATGCGGACGAGCTTCTACCGCGC
GATATCTCGGAAAAACCCGAGGAATGGCAGAGGGGCTACTTTGATGCCATCATGCTGGCAGCCAAGGCGGCCGAG
CACGTCGATGGATGGCTCTTCGATCGTCTACTTAAAGTCACCGTCCCCCCTGAATGCGTCTTCGGGCCTTTGAAC
CCTCGGCCGCGTCCGATTCGGTCTGGAGTCTCGGGTGTCCCGCGAGTGGAAGACTGCCAGCCGGCATATCCCTCG
GCCGAGAGCTGGTACATGAAAATACTTGGCACTGAAGGCTTCTCGCAGAGGCAAAGGGTCGATGCCACGCTTGCG
TACGCTAGCTTTATGCAGTTCAAGAATCAGGTCGAGCAGGCCGAGGCCTTGTATGATCTGGCCTTGGCTGAGGCT
ACCAACAAGGTTGAGCCGGCTCGTCTGCCCTACGACACGAAGACGCTTGTCCTTAAAGACGAAGGCGAGCCGCCA
TCGGACAACATGCTCGAGGTCCTCACCGCCATCGCCAACTTCAAGGCCCGCAAAGGCCAACTCTCATCAGCCCTC
CCCATGTACGTCTCACTCCTCCAAGCACGCCGCCGTCTCTCGAACACGCCCCCTCCTCCGACGTCGTCTCGCCCA
CCTCCGTCCTTTGTCGATCAAGTGACGGGCTGGTTCAAGCAGCCACCCTATCCCGAATCCCCCGGGGACGGCACC
GGGCCTCCGTGGCGCAACACCCTCGAGCGCTGTCAAGAAGCGGCGCTGCACCTCTATATCGGCGAGATACTATTC
GCCACCTCTTCGCGAACAAATGGCCTGGCGTGGACGCGAGACGCCGTCGATATCGCAGAGGAGCAGCTCCGCGAC
GGCAGTCTCACCAAGATGGAAAAGGAAGCAAAGCAGAGATGTCGAGAGTGCCTCGCCGCAAGTCTGAATAACTGG
TCGGCCATGGCGGCGCAGTTGGCCGAGGCCGAGCAGGCCAAGAATGAAAAGAGCCGAGGCAAATCTGGACTGTTG
CCCTTTTGGCGCGTAGCGCAGGAGCCACAGGAAGCGAACAGTCGCTGGAGTAGCGAGCAGGCTGCGGTGGAGGCG
CGGGCGGATAGGGCGAAGGAGCTGTTGAATGATGATTTGGAGGCACAGTCGGGGGGACTTCTTTCTTTCTTCAGG
GCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail