Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|03819
Gene name
Locationscaffold_04:24097..25930
Strand-
Gene length (bp)1833
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 1.3E-06 142 212
PF00651 BTB BTB/POZ domain 8.3E-13 309 393
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.2E-07 40 92
PF13637 Ank_4 Ankyrin repeats (many copies) 5.2E-06 42 88

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6696 0.598 0.0429 0.0602 0.0532 0.0162 0.2075 0.2302 0.1609 0.0103

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2902
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6474
Ophiocordyceps australis map64 (Brazil) OphauB2|855
Ophiocordyceps camponoti-floridani Ophcf2|03819 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1159
Ophiocordyceps kimflemingae Ophio5|6902
Ophiocordyceps subramaniannii Hirsu2|4843

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|03819
MVLPKHELEGKLGEERLLIESGLLRDENSLDLSVEFTEFLLACRDGDLRRCRELINQGVNVNGKDEFDHTPLFMA
SMCGHYKLVQLLLESGALAEKNTVQGERCIRNAFNGRIRSLLLRYDFNKSADPYVYWSTHLSSLLERETPATSDM
CLVAGPRSFRLHRFFLFARTSYFRDRLDAQPETTSWNLPPGVPPEAVHIALRNLYLDHVPTDLAPSAGSSSVSED
DIAKGHRDEEERALQQIGNFFRDRVLGGKMVVDTDRVSDVRIGSDNTAFADVLLRADELSASCPPLLNSQGISQS
PRMSKSVLYPCHKAMLIRSKYFATMFSGDFIEAQTSDHLHIVTVDCSPAVLELVLSYLYTDGVRCPLEHALDLLY
TADMLCLDSLKTKAAVAISTLGSGNAVVDGDEQEPINIYDVIHAAWTLRVQRLEQFAARYLADRLEDYIDDSDFH
ELVRESAPRIRRREETDSIELLDDIRFYLWDRFRLRYEDAGIIGVISSMTANGRIPTRLILSGDADKDAFDSAAG
QYRELQQKIDDMLESLKLDA*
Coding >Ophcf2|03819
ATGGTGCTGCCGAAGCACGAGCTCGAGGGCAAGCTGGGCGAGGAGAGGCTCCTGATCGAAAGCGGCCTGCTGCGC
GACGAGAACTCGCTCGACCTAAGCGTAGAGTTCACTGAATTTCTGCTCGCTTGTCGCGACGGTGATTTGCGTCGC
TGTCGGGAGCTAATCAATCAGGGTGTCAACGTCAACGGCAAGGACGAGTTTGACCACACGCCCCTCTTCATGGCC
AGTATGTGCGGCCACTACAAACTCGTGCAGCTGCTTCTCGAAAGTGGTGCGCTGGCAGAGAAAAACACGGTCCAG
GGTGAGCGATGCATCCGCAACGCCTTCAATGGCCGCATCCGCAGCCTTCTTCTGCGCTATGACTTTAATAAATCC
GCGGACCCCTACGTCTATTGGTCGACGCATCTATCCAGTCTCCTGGAGAGGGAGACGCCGGCGACGTCGGACATG
TGTCTGGTCGCCGGGCCGCGCTCTTTCCGTCTGCACAGGTTTTTTCTCTTTGCACGCACGTCCTACTTTCGCGAC
CGGCTCGATGCTCAACCCGAGACAACGTCGTGGAATTTGCCTCCCGGCGTACCCCCGGAGGCGGTCCACATTGCG
CTGCGGAACCTGTATCTTGATCACGTCCCTACCGATCTTGCTCCGTCCGCCGGCAGCAGCTCCGTCTCGGAAGAC
GACATCGCCAAGGGTCATCGAGACGAAGAGGAGCGCGCGCTACAGCAGATTGGCAACTTTTTCCGCGATCGCGTC
CTTGGCGGCAAGATGGTCGTGGACACCGATCGAGTCTCAGACGTCCGGATCGGGTCGGACAACACAGCGTTTGCC
GATGTCCTGCTTCGTGCCGACGAGCTGTCGGCCTCGTGTCCGCCGCTCCTCAACAGCCAAGGCATTTCTCAGAGT
CCGCGAATGTCAAAATCAGTACTATACCCGTGCCACAAGGCCATGCTTATTCGCAGCAAGTACTTCGCCACCATG
TTCTCCGGCGACTTCATCGAGGCTCAGACGTCAGATCATCTGCACATCGTCACCGTCGACTGCTCGCCCGCCGTC
CTTGAGCTCGTTCTCTCGTACCTCTACACCGACGGCGTCCGCTGCCCGCTTGAGCATGCCCTCGACCTGCTCTAC
ACGGCTGATATGCTCTGTCTCGACAGCCTCAAGACTAAAGCTGCCGTCGCCATCAGCACGCTGGGCAGCGGAAAC
GCCGTCGTGGACGGTGACGAACAGGAGCCCATCAACATTTACGATGTCATTCACGCTGCTTGGACCCTGCGCGTC
CAGCGGCTAGAGCAATTCGCTGCCCGCTACCTCGCTGACCGGCTGGAGGATTACATTGACGATTCGGACTTTCAC
GAGCTCGTTCGCGAGAGCGCACCGCGCATTCGTCGGCGAGAGGAGACAGACTCGATCGAGCTGTTGGATGATATC
AGGTTTTATCTCTGGGATCGCTTTCGTCTGCGCTACGAAGACGCTGGCATAATCGGCGTCATATCCTCGATGACT
GCCAACGGCAGGATACCTACTCGCTTGATTCTCAGTGGCGATGCGGATAAAGATGCGTTTGACTCTGCAGCCGGC
CAGTACCGCGAACTTCAGCAGAAGATTGACGACATGCTTGAAAGCCTCAAGCTAGACGCGTGA
Transcript >Ophcf2|03819
ATGGTGCTGCCGAAGCACGAGCTCGAGGGCAAGCTGGGCGAGGAGAGGCTCCTGATCGAAAGCGGCCTGCTGCGC
GACGAGAACTCGCTCGACCTAAGCGTAGAGTTCACTGAATTTCTGCTCGCTTGTCGCGACGGTGATTTGCGTCGC
TGTCGGGAGCTAATCAATCAGGGTGTCAACGTCAACGGCAAGGACGAGTTTGACCACACGCCCCTCTTCATGGCC
AGTATGTGCGGCCACTACAAACTCGTGCAGCTGCTTCTCGAAAGTGGTGCGCTGGCAGAGAAAAACACGGTCCAG
GGTGAGCGATGCATCCGCAACGCCTTCAATGGCCGCATCCGCAGCCTTCTTCTGCGCTATGACTTTAATAAATCC
GCGGACCCCTACGTCTATTGGTCGACGCATCTATCCAGTCTCCTGGAGAGGGAGACGCCGGCGACGTCGGACATG
TGTCTGGTCGCCGGGCCGCGCTCTTTCCGTCTGCACAGGTTTTTTCTCTTTGCACGCACGTCCTACTTTCGCGAC
CGGCTCGATGCTCAACCCGAGACAACGTCGTGGAATTTGCCTCCCGGCGTACCCCCGGAGGCGGTCCACATTGCG
CTGCGGAACCTGTATCTTGATCACGTCCCTACCGATCTTGCTCCGTCCGCCGGCAGCAGCTCCGTCTCGGAAGAC
GACATCGCCAAGGGTCATCGAGACGAAGAGGAGCGCGCGCTACAGCAGATTGGCAACTTTTTCCGCGATCGCGTC
CTTGGCGGCAAGATGGTCGTGGACACCGATCGAGTCTCAGACGTCCGGATCGGGTCGGACAACACAGCGTTTGCC
GATGTCCTGCTTCGTGCCGACGAGCTGTCGGCCTCGTGTCCGCCGCTCCTCAACAGCCAAGGCATTTCTCAGAGT
CCGCGAATGTCAAAATCAGTACTATACCCGTGCCACAAGGCCATGCTTATTCGCAGCAAGTACTTCGCCACCATG
TTCTCCGGCGACTTCATCGAGGCTCAGACGTCAGATCATCTGCACATCGTCACCGTCGACTGCTCGCCCGCCGTC
CTTGAGCTCGTTCTCTCGTACCTCTACACCGACGGCGTCCGCTGCCCGCTTGAGCATGCCCTCGACCTGCTCTAC
ACGGCTGATATGCTCTGTCTCGACAGCCTCAAGACTAAAGCTGCCGTCGCCATCAGCACGCTGGGCAGCGGAAAC
GCCGTCGTGGACGGTGACGAACAGGAGCCCATCAACATTTACGATGTCATTCACGCTGCTTGGACCCTGCGCGTC
CAGCGGCTAGAGCAATTCGCTGCCCGCTACCTCGCTGACCGGCTGGAGGATTACATTGACGATTCGGACTTTCAC
GAGCTCGTTCGCGAGAGCGCACCGCGCATTCGTCGGCGAGAGGAGACAGACTCGATCGAGCTGTTGGATGATATC
AGGTTTTATCTCTGGGATCGCTTTCGTCTGCGCTACGAAGACGCTGGCATAATCGGCGTCATATCCTCGATGACT
GCCAACGGCAGGATACCTACTCGCTTGATTCTCAGTGGCGATGCGGATAAAGATGCGTTTGACTCTGCAGCCGGC
CAGTACCGCGAACTTCAGCAGAAGATTGACGACATGCTTGAAAGCCTCAAGCTAGACGCGTGA
Gene >Ophcf2|03819
ATGGTGCTGCCGAAGCACGAGCTCGAGGGCAAGCTGGGCGAGGAGAGGCTCCTGATCGAAAGCGGCCTGCTGCGC
GACGAGAACTCGCTCGACCTAAGCGTAGAGTTCACTGAATTTCTGCTCGCTTGTCGCGACGGTGATTTGCGTCGC
TGTCGGGAGCTAATCAATCAGGGTGTCAACGTCAACGGCAAGGACGAGTTTGACCACACGCCCCTCTTCATGGTG
AGCGCCTCGATTGATCCGCTGTAACCCTCCCTGTCACTGACCGGTCCGCTCCCGTCCAGGCCAGTATGTGCGGCC
ACTACAAACTCGTGCAGCTGCTTCTCGAAAGTGGTACGCCAGTTGTCCGCCACAAACACGCACACTCCCCCCTTC
CTCTCCTTGAGTGTCACAGCCGCCGGCCCGCCGCACTGACGGAGTCCAAGGAGAGGGGAAACATCTCTTGCTGAC
GCGATCCGTCTCGCAGGTGCGCTGGCAGAGAAAAACACGGTCCAGGGTGAGCGATGCATCCGCAACGCCTTCAAT
GGCCGCATCCGCAGCCTTCTTCTGCGCTATGACTTTAATAAATCCGCGGACCCCTACGTCTATTGGTCGACGCAT
CTATCCAGTCTCCTGGAGAGGGAGACGCCGGCGACGTCGGACATGTGTCTGGTCGCCGGGCCGCGCTCTTTCCGT
CTGCACAGGTTTTTTCTCTTTGCACGCACGTCCTACTTTCGCGACCGGCTCGATGCTCAACCCGAGACAACGTCG
TGGAATTTGCCTCCCGGCGTACCCCCGGAGGCGGTCCACATTGCGCTGCGGAACCTGTATCTTGATCACGTCCCT
ACCGATCTTGCTCCGTCCGCCGGCAGCAGCTCCGTCTCGGAAGACGACATCGCCAAGGGTCATCGAGACGAAGAG
GAGCGCGCGCTACAGCAGATTGGCAACTTTTTCCGCGATCGCGTCCTTGGCGGCAAGATGGTCGTGGACACCGAT
CGAGTCTCAGACGTCCGGATCGGGTCGGACAACACAGCGTTTGCCGATGTCCTGCTTCGTGCCGACGAGCTGTCG
GCCTCGTGTCCGCCGCTCCTCAACAGCCAAGGCATTTCTCAGAGTCCGCGAATGTCAAAATCAGTACTATACCCG
TGCCACAAGGCCATGCTTATTCGCAGCAAGTACTTCGCCACCATGTTCTCCGGCGACTTCATCGAGGCTCAGACG
TCAGATCATCTGCACATCGTCACCGTCGACTGCTCGCCCGCCGTCCTTGAGCTCGTTCTCTCGTACCTCTACACC
GACGGCGTCCGCTGCCCGCTTGAGCATGCCCTCGACCTGCTCTACACGGCTGATATGCTCTGTCTCGACAGCCTC
AAGACTAAAGCTGCCGTCGCCATCAGCACGCTGGGCAGCGGAAACGCCGTCGTGGACGGTGACGAACAGGAGCCC
ATCAACATTTACGATGTCATTCACGCTGCTTGGACCCTGCGCGTCCAGCGGCTAGAGCAATTCGCTGCCCGCTAC
CTCGCTGACCGGCTGGAGGATTACATTGACGATTCGGACTTTCACGAGCTCGTTCGCGAGAGCGCACCGCGCATT
CGTCGGCGAGAGGAGACAGACTCGATCGAGCTGTTGGATGATATCAGGTTTTATCTCTGGGATCGCTTTCGTCTG
CGCTACGAAGACGCTGGCATAATCGGCGTCATATCCTCGATGACTGCCAACGGCAGGATACCTACTCGCTTGATT
CTCAGTGGCGATGCGGATAAAGATGCGTTTGACTCTGCAGCCGGCCAGTACCGCGAACTTCAGCAGAAGATTGAC
GACATGCTTGAAAGCCTCAAGCTAGACGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail